Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A439DE38

Protein Details
Accession A0A439DE38    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-88IHYATMKPEQKKKKEKKGDKGEKKPGGKPPABasic
NLS Segment(s)
PositionSequence
66-90EQKKKKEKKGDKGEKKPGGKPPAQR
Subcellular Location(s) mito 7cyto 7cyto_mito 7, plas 5, extr 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSAPQRSSPPVQGQFAWFAKIGGTPEVVATLNDQPYVFFVLLAALIILILEGVFIWYIHYATMKPEQKKKKEKKGDKGEKKPGGKPPAQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.36
4 0.26
5 0.21
6 0.19
7 0.19
8 0.18
9 0.12
10 0.12
11 0.1
12 0.09
13 0.11
14 0.1
15 0.09
16 0.1
17 0.11
18 0.11
19 0.12
20 0.11
21 0.1
22 0.11
23 0.13
24 0.1
25 0.07
26 0.07
27 0.06
28 0.06
29 0.06
30 0.05
31 0.02
32 0.02
33 0.02
34 0.02
35 0.01
36 0.01
37 0.01
38 0.01
39 0.02
40 0.02
41 0.02
42 0.03
43 0.03
44 0.04
45 0.04
46 0.05
47 0.05
48 0.08
49 0.18
50 0.24
51 0.3
52 0.39
53 0.49
54 0.59
55 0.7
56 0.77
57 0.8
58 0.84
59 0.89
60 0.91
61 0.93
62 0.94
63 0.94
64 0.94
65 0.94
66 0.92
67 0.88
68 0.84
69 0.82
70 0.8