Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A439D0D2

Protein Details
Accession A0A439D0D2   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MIYSYPKTAKRQTPKLQIDDIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 7, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012882  Fmp46  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF07955  DUF1687  
Amino Acid Sequences MIYSYPKTAKRQTPKLQIDDIISIHALYYSSYPFPDSHHVSIQQHKTLDIVTLFHKAGSPASVRAATVLKQASANATESATEDQASDHSHQTNPHRPDFELNITEDPPTADQLKTILEYVGKNKISSVIKGATTENEALKKFKESADNLKRPVVVDWNNGKAIASDNESEILKMLNQLNDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.76
4 0.68
5 0.61
6 0.53
7 0.44
8 0.34
9 0.26
10 0.2
11 0.15
12 0.13
13 0.1
14 0.07
15 0.08
16 0.09
17 0.1
18 0.1
19 0.12
20 0.12
21 0.15
22 0.22
23 0.26
24 0.27
25 0.3
26 0.34
27 0.36
28 0.44
29 0.46
30 0.43
31 0.38
32 0.35
33 0.31
34 0.27
35 0.26
36 0.18
37 0.14
38 0.11
39 0.14
40 0.14
41 0.14
42 0.14
43 0.12
44 0.12
45 0.13
46 0.13
47 0.1
48 0.12
49 0.13
50 0.12
51 0.13
52 0.14
53 0.12
54 0.14
55 0.14
56 0.12
57 0.12
58 0.12
59 0.12
60 0.12
61 0.13
62 0.09
63 0.09
64 0.09
65 0.09
66 0.1
67 0.09
68 0.08
69 0.07
70 0.06
71 0.07
72 0.09
73 0.09
74 0.1
75 0.11
76 0.12
77 0.15
78 0.21
79 0.29
80 0.31
81 0.32
82 0.33
83 0.32
84 0.34
85 0.34
86 0.32
87 0.25
88 0.23
89 0.21
90 0.2
91 0.19
92 0.17
93 0.13
94 0.1
95 0.1
96 0.1
97 0.09
98 0.08
99 0.09
100 0.1
101 0.1
102 0.1
103 0.09
104 0.09
105 0.1
106 0.13
107 0.19
108 0.19
109 0.18
110 0.18
111 0.24
112 0.24
113 0.24
114 0.25
115 0.21
116 0.21
117 0.22
118 0.23
119 0.18
120 0.19
121 0.2
122 0.18
123 0.19
124 0.2
125 0.2
126 0.2
127 0.22
128 0.21
129 0.22
130 0.27
131 0.28
132 0.38
133 0.48
134 0.53
135 0.52
136 0.54
137 0.52
138 0.45
139 0.43
140 0.4
141 0.34
142 0.36
143 0.39
144 0.4
145 0.4
146 0.39
147 0.37
148 0.29
149 0.28
150 0.23
151 0.2
152 0.17
153 0.18
154 0.2
155 0.2
156 0.19
157 0.16
158 0.14
159 0.11
160 0.15
161 0.17