Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A439D3J6

Protein Details
Accession A0A439D3J6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
66-89TATTSNSINKKRKKDGPKPIITTEHydrophilic
NLS Segment(s)
PositionSequence
75-81KKRKKDG
Subcellular Location(s) nucl 16.5, cyto_nucl 11.833, cyto_mito 4.999, mito 4.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MNSAKDATNSDPVPAPAPATITASKSAATAGVDAINAAATPPTAQSTTVPLMAGANGSGTSSASGTATTSNSINKKRKKDGPKPIITTEGPAPM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.14
4 0.16
5 0.15
6 0.17
7 0.17
8 0.16
9 0.18
10 0.17
11 0.17
12 0.15
13 0.14
14 0.11
15 0.1
16 0.08
17 0.07
18 0.07
19 0.06
20 0.06
21 0.06
22 0.05
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.05
30 0.05
31 0.06
32 0.06
33 0.1
34 0.11
35 0.11
36 0.11
37 0.09
38 0.09
39 0.09
40 0.08
41 0.05
42 0.04
43 0.03
44 0.03
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.06
54 0.07
55 0.08
56 0.09
57 0.14
58 0.2
59 0.29
60 0.38
61 0.45
62 0.54
63 0.61
64 0.7
65 0.76
66 0.81
67 0.83
68 0.85
69 0.87
70 0.84
71 0.79
72 0.76
73 0.65
74 0.59