Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A439CY15

Protein Details
Accession A0A439CY15    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
58-83EAYRACKKEWITKRKEEKKKAGGFFSHydrophilic
NLS Segment(s)
PositionSequence
70-77KRKEEKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSAPADDAQDPWDKETRRKFQNKSTSEYFDPCQEAASRSIQCLRRNAGDRTMCTDYFEAYRACKKEWITKRKEEKKKAGGFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.45
3 0.51
4 0.55
5 0.64
6 0.66
7 0.7
8 0.78
9 0.74
10 0.71
11 0.68
12 0.63
13 0.56
14 0.54
15 0.45
16 0.37
17 0.35
18 0.27
19 0.23
20 0.18
21 0.17
22 0.16
23 0.19
24 0.16
25 0.15
26 0.21
27 0.25
28 0.27
29 0.29
30 0.29
31 0.3
32 0.35
33 0.36
34 0.37
35 0.36
36 0.34
37 0.37
38 0.39
39 0.33
40 0.31
41 0.29
42 0.23
43 0.2
44 0.21
45 0.16
46 0.15
47 0.21
48 0.22
49 0.23
50 0.26
51 0.29
52 0.37
53 0.47
54 0.54
55 0.56
56 0.64
57 0.74
58 0.8
59 0.88
60 0.88
61 0.88
62 0.88
63 0.9