Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G7X8R5

Protein Details
Accession G7X8R5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPSRKSKSNPKSNLPRNRWSMYHydrophilic
136-155ERPVYDERKRTKPHNRELCEBasic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
Pfam View protein in Pfam  
PF13695  zf-3CxxC  
Amino Acid Sequences MPSRKSKSNPKSNLPRNRWSMYPALHSDVLNHLSSSLPITSLTFHPFDDATSSRKEYDTNIMGRFVCSNDSCTSTGWTSKKIAITIRLYSGDEYNARVYHQRCKKCNSLSRPFLDEDSYAERIAYRMKKWYGVDVERPVYDERKRTKPHNRELCEGCKAGRCSFAEGVWDEDDSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.81
4 0.76
5 0.68
6 0.61
7 0.57
8 0.49
9 0.48
10 0.42
11 0.4
12 0.38
13 0.36
14 0.33
15 0.3
16 0.3
17 0.24
18 0.2
19 0.16
20 0.14
21 0.15
22 0.15
23 0.11
24 0.08
25 0.08
26 0.09
27 0.1
28 0.12
29 0.15
30 0.14
31 0.13
32 0.14
33 0.14
34 0.14
35 0.16
36 0.16
37 0.15
38 0.18
39 0.2
40 0.19
41 0.2
42 0.2
43 0.18
44 0.23
45 0.26
46 0.26
47 0.25
48 0.26
49 0.25
50 0.25
51 0.24
52 0.17
53 0.15
54 0.12
55 0.14
56 0.13
57 0.16
58 0.17
59 0.16
60 0.18
61 0.16
62 0.21
63 0.19
64 0.2
65 0.19
66 0.21
67 0.21
68 0.21
69 0.21
70 0.21
71 0.23
72 0.22
73 0.22
74 0.2
75 0.2
76 0.19
77 0.17
78 0.14
79 0.11
80 0.11
81 0.11
82 0.1
83 0.11
84 0.15
85 0.16
86 0.23
87 0.31
88 0.38
89 0.4
90 0.46
91 0.53
92 0.57
93 0.65
94 0.65
95 0.66
96 0.65
97 0.65
98 0.63
99 0.56
100 0.48
101 0.41
102 0.32
103 0.25
104 0.23
105 0.21
106 0.18
107 0.16
108 0.15
109 0.14
110 0.21
111 0.22
112 0.19
113 0.25
114 0.26
115 0.32
116 0.33
117 0.39
118 0.4
119 0.4
120 0.45
121 0.43
122 0.44
123 0.39
124 0.4
125 0.36
126 0.34
127 0.34
128 0.36
129 0.37
130 0.44
131 0.5
132 0.57
133 0.66
134 0.71
135 0.78
136 0.8
137 0.79
138 0.77
139 0.78
140 0.75
141 0.69
142 0.6
143 0.52
144 0.49
145 0.47
146 0.41
147 0.41
148 0.36
149 0.37
150 0.37
151 0.36
152 0.32
153 0.3
154 0.32
155 0.27