Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A439D7Q8

Protein Details
Accession A0A439D7Q8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-74LVNESRRPESKHQRPPRRRLAVPHydrophilic
NLS Segment(s)
PositionSequence
61-70SKHQRPPRRR
Subcellular Location(s) cyto 11.5, cyto_nucl 11.5, nucl 10.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013950  Mis14/Nsl1  
Gene Ontology GO:0000776  C:kinetochore  
GO:0000070  P:mitotic sister chromatid segregation  
Pfam View protein in Pfam  
PF08641  Mis14  
Amino Acid Sequences MDSARKIELQVAEDLAYLVANVRRAATARIDEAFPPVDDSSEDELRTRIEELVNESRRPESKHQRPPRRRLAVPVPRGSSNPLASSEPEEVFEPFDARKRARVEALTTEEEDLLRDIAHLKKSVPGTVAGAWAEAARKGVKDDEEALERVNLAAAQFGKLTTSDPSAAAAAGDGSVLAITPLEHQDDVETSFGDAVRGLGRLKKEMPAVVARMERARKAGEYVITER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.14
3 0.11
4 0.08
5 0.09
6 0.09
7 0.11
8 0.11
9 0.12
10 0.13
11 0.14
12 0.17
13 0.19
14 0.2
15 0.21
16 0.22
17 0.23
18 0.22
19 0.24
20 0.23
21 0.18
22 0.18
23 0.16
24 0.15
25 0.14
26 0.18
27 0.21
28 0.21
29 0.21
30 0.19
31 0.19
32 0.19
33 0.2
34 0.17
35 0.13
36 0.12
37 0.13
38 0.19
39 0.28
40 0.31
41 0.31
42 0.31
43 0.33
44 0.35
45 0.39
46 0.42
47 0.43
48 0.5
49 0.6
50 0.7
51 0.78
52 0.85
53 0.89
54 0.91
55 0.88
56 0.79
57 0.76
58 0.76
59 0.74
60 0.72
61 0.68
62 0.6
63 0.53
64 0.52
65 0.48
66 0.41
67 0.32
68 0.26
69 0.22
70 0.2
71 0.19
72 0.22
73 0.2
74 0.16
75 0.16
76 0.15
77 0.13
78 0.13
79 0.12
80 0.1
81 0.09
82 0.13
83 0.15
84 0.15
85 0.21
86 0.23
87 0.24
88 0.26
89 0.27
90 0.25
91 0.27
92 0.31
93 0.27
94 0.24
95 0.23
96 0.2
97 0.18
98 0.15
99 0.11
100 0.06
101 0.05
102 0.04
103 0.06
104 0.08
105 0.1
106 0.1
107 0.11
108 0.14
109 0.15
110 0.16
111 0.15
112 0.14
113 0.14
114 0.14
115 0.15
116 0.1
117 0.1
118 0.09
119 0.08
120 0.08
121 0.06
122 0.07
123 0.06
124 0.06
125 0.08
126 0.09
127 0.1
128 0.11
129 0.14
130 0.15
131 0.17
132 0.17
133 0.17
134 0.15
135 0.14
136 0.12
137 0.1
138 0.07
139 0.05
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.08
146 0.08
147 0.09
148 0.08
149 0.1
150 0.11
151 0.11
152 0.12
153 0.11
154 0.11
155 0.1
156 0.08
157 0.06
158 0.05
159 0.04
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.02
166 0.03
167 0.05
168 0.07
169 0.09
170 0.09
171 0.09
172 0.1
173 0.12
174 0.13
175 0.12
176 0.11
177 0.09
178 0.1
179 0.1
180 0.09
181 0.08
182 0.08
183 0.08
184 0.09
185 0.1
186 0.13
187 0.15
188 0.2
189 0.21
190 0.25
191 0.27
192 0.28
193 0.31
194 0.32
195 0.32
196 0.33
197 0.33
198 0.31
199 0.35
200 0.37
201 0.35
202 0.33
203 0.34
204 0.3
205 0.32
206 0.34
207 0.32