Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A439CM74

Protein Details
Accession A0A439CM74    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-46RGRRRRLRARERREHRKDDEKTRRNREKREKKRRARERAKNAGEGDBasic
NLS Segment(s)
PositionSequence
2-41GRRRRLRARERREHRKDDEKTRRNREKREKKRRARERAKN
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences RGRRRRLRARERREHRKDDEKTRRNREKREKKRRARERAKNAGEGDGGGAAPAAAVRNGTAGAVSQNGVVKSRIERRKNDEEDGEDTVQDAVDQTMEVTKGIVIEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.87
3 0.87
4 0.84
5 0.84
6 0.85
7 0.83
8 0.84
9 0.86
10 0.89
11 0.86
12 0.89
13 0.89
14 0.89
15 0.91
16 0.93
17 0.93
18 0.93
19 0.95
20 0.95
21 0.95
22 0.95
23 0.94
24 0.93
25 0.93
26 0.86
27 0.8
28 0.7
29 0.6
30 0.49
31 0.38
32 0.27
33 0.17
34 0.12
35 0.06
36 0.05
37 0.03
38 0.03
39 0.03
40 0.03
41 0.02
42 0.02
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.05
51 0.05
52 0.05
53 0.07
54 0.08
55 0.09
56 0.1
57 0.1
58 0.15
59 0.24
60 0.33
61 0.37
62 0.43
63 0.5
64 0.6
65 0.64
66 0.64
67 0.58
68 0.53
69 0.51
70 0.49
71 0.42
72 0.31
73 0.27
74 0.22
75 0.18
76 0.14
77 0.1
78 0.05
79 0.05
80 0.05
81 0.05
82 0.07
83 0.08
84 0.08
85 0.07
86 0.08
87 0.08