Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A439CRW1

Protein Details
Accession A0A439CRW1    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
10-59EKSADQRRDAPRRVRKIQKPRTAKAPRRVMIPRPRQKARRRTPEPEHPVMBasic
NLS Segment(s)
PositionSequence
16-51RRDAPRRVRKIQKPRTAKAPRRVMIPRPRQKARRRT
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MGCHISKETEKSADQRRDAPRRVRKIQKPRTAKAPRRVMIPRPRQKARRRTPEPEHPVMTEGELDELYAIIERPLRLRPAPMDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.58
4 0.63
5 0.68
6 0.72
7 0.72
8 0.73
9 0.8
10 0.82
11 0.82
12 0.84
13 0.87
14 0.86
15 0.85
16 0.79
17 0.81
18 0.81
19 0.8
20 0.78
21 0.78
22 0.69
23 0.67
24 0.67
25 0.65
26 0.64
27 0.66
28 0.65
29 0.63
30 0.69
31 0.71
32 0.76
33 0.79
34 0.79
35 0.79
36 0.78
37 0.79
38 0.8
39 0.82
40 0.81
41 0.75
42 0.67
43 0.56
44 0.5
45 0.42
46 0.34
47 0.24
48 0.16
49 0.11
50 0.09
51 0.08
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.08
59 0.09
60 0.11
61 0.15
62 0.2
63 0.21
64 0.26