Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A439DGH5

Protein Details
Accession A0A439DGH5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
342-371EKERMIQEQKMEKRKRKKAEKENRTPEERABasic
392-440EEAKYQLKLLKRARKRERRAISKERKELELARKKERRELAKQKEAQKLABasic
NLS Segment(s)
PositionSequence
134-139KGAKKG
351-434KMEKRKRKKAEKENRTPEERAELAAKRAKVMEEKRLARTEKEEAKYQLKLLKRARKRERRAISKERKELELARKKERRELAKQK
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR047021  REXO1/3/4-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0004527  F:exonuclease activity  
GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MRALGRCGVLYRPHSLGPHRILYRTLHANRRLGPALPGPASSCSAEAPCILRRNGNTPVAVTTAHRRNFSASGWQNGKRAKAPKPPHYKWASSVVSDDVYDVYSALESHILDSGRFESERFPVTSATPDSGAKKGAKKGVPRTRDPHNPENQSPPSPDPDDLEPRSTYDALVIDCEMTSSPAASYCAASCGRRAPVTDWRRGITGFNKPMMMEAVKKGKTLPGWEKVRERIFDVTTSETIFIGHALANDLRVLRIATDRVVDSMMMMSRAVYGDEGKPLRNWGLKAACQELLDVAVQKTRGPHRPIEDVFGTRELVLHCVRNPEKLAEWGARTRAGIAAAAEKERMIQEQKMEKRKRKKAEKENRTPEERAELAAKRAKVMEEKRLARTEKEEAKYQLKLLKRARKRERRAISKERKELELARKKERRELAKQKEAQKLAGQEEEQEKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.45
4 0.44
5 0.49
6 0.47
7 0.46
8 0.46
9 0.45
10 0.47
11 0.49
12 0.51
13 0.51
14 0.55
15 0.59
16 0.61
17 0.64
18 0.59
19 0.5
20 0.46
21 0.42
22 0.42
23 0.37
24 0.33
25 0.28
26 0.28
27 0.29
28 0.26
29 0.21
30 0.17
31 0.17
32 0.17
33 0.17
34 0.18
35 0.22
36 0.27
37 0.27
38 0.31
39 0.33
40 0.38
41 0.43
42 0.43
43 0.38
44 0.34
45 0.35
46 0.31
47 0.29
48 0.26
49 0.27
50 0.32
51 0.35
52 0.35
53 0.34
54 0.37
55 0.38
56 0.38
57 0.39
58 0.35
59 0.39
60 0.44
61 0.46
62 0.47
63 0.48
64 0.5
65 0.47
66 0.5
67 0.5
68 0.55
69 0.61
70 0.66
71 0.73
72 0.73
73 0.76
74 0.76
75 0.7
76 0.63
77 0.63
78 0.56
79 0.46
80 0.43
81 0.36
82 0.3
83 0.26
84 0.23
85 0.14
86 0.11
87 0.1
88 0.08
89 0.06
90 0.06
91 0.06
92 0.06
93 0.07
94 0.06
95 0.07
96 0.1
97 0.1
98 0.1
99 0.11
100 0.12
101 0.13
102 0.13
103 0.13
104 0.13
105 0.15
106 0.19
107 0.18
108 0.18
109 0.17
110 0.18
111 0.22
112 0.21
113 0.19
114 0.17
115 0.18
116 0.19
117 0.19
118 0.22
119 0.22
120 0.26
121 0.29
122 0.35
123 0.38
124 0.43
125 0.53
126 0.59
127 0.61
128 0.63
129 0.62
130 0.63
131 0.68
132 0.68
133 0.66
134 0.66
135 0.66
136 0.62
137 0.66
138 0.62
139 0.54
140 0.5
141 0.43
142 0.39
143 0.34
144 0.32
145 0.26
146 0.27
147 0.31
148 0.3
149 0.31
150 0.26
151 0.25
152 0.27
153 0.25
154 0.2
155 0.14
156 0.14
157 0.11
158 0.11
159 0.1
160 0.08
161 0.07
162 0.08
163 0.06
164 0.06
165 0.05
166 0.05
167 0.05
168 0.05
169 0.07
170 0.07
171 0.07
172 0.07
173 0.1
174 0.11
175 0.11
176 0.12
177 0.14
178 0.16
179 0.16
180 0.18
181 0.18
182 0.27
183 0.32
184 0.37
185 0.36
186 0.35
187 0.35
188 0.34
189 0.33
190 0.27
191 0.31
192 0.27
193 0.26
194 0.26
195 0.25
196 0.25
197 0.23
198 0.2
199 0.13
200 0.13
201 0.19
202 0.19
203 0.19
204 0.19
205 0.2
206 0.2
207 0.25
208 0.27
209 0.29
210 0.33
211 0.36
212 0.39
213 0.42
214 0.44
215 0.39
216 0.36
217 0.3
218 0.27
219 0.25
220 0.23
221 0.2
222 0.17
223 0.17
224 0.15
225 0.11
226 0.1
227 0.09
228 0.07
229 0.06
230 0.05
231 0.05
232 0.06
233 0.06
234 0.06
235 0.07
236 0.07
237 0.06
238 0.06
239 0.06
240 0.05
241 0.07
242 0.07
243 0.08
244 0.09
245 0.09
246 0.09
247 0.09
248 0.08
249 0.07
250 0.07
251 0.07
252 0.06
253 0.06
254 0.05
255 0.05
256 0.06
257 0.06
258 0.05
259 0.07
260 0.07
261 0.12
262 0.13
263 0.13
264 0.14
265 0.15
266 0.18
267 0.2
268 0.2
269 0.21
270 0.24
271 0.26
272 0.28
273 0.29
274 0.28
275 0.25
276 0.24
277 0.18
278 0.15
279 0.13
280 0.12
281 0.09
282 0.09
283 0.09
284 0.1
285 0.15
286 0.2
287 0.27
288 0.3
289 0.34
290 0.37
291 0.45
292 0.45
293 0.45
294 0.42
295 0.36
296 0.34
297 0.3
298 0.26
299 0.18
300 0.19
301 0.14
302 0.15
303 0.15
304 0.15
305 0.15
306 0.23
307 0.24
308 0.26
309 0.28
310 0.27
311 0.27
312 0.28
313 0.3
314 0.25
315 0.27
316 0.27
317 0.27
318 0.26
319 0.24
320 0.22
321 0.19
322 0.16
323 0.14
324 0.12
325 0.15
326 0.14
327 0.15
328 0.14
329 0.13
330 0.14
331 0.14
332 0.16
333 0.15
334 0.16
335 0.22
336 0.31
337 0.4
338 0.49
339 0.58
340 0.65
341 0.73
342 0.8
343 0.84
344 0.86
345 0.89
346 0.9
347 0.91
348 0.93
349 0.93
350 0.94
351 0.91
352 0.87
353 0.77
354 0.68
355 0.63
356 0.53
357 0.43
358 0.38
359 0.33
360 0.33
361 0.36
362 0.34
363 0.29
364 0.3
365 0.3
366 0.34
367 0.37
368 0.4
369 0.45
370 0.49
371 0.54
372 0.59
373 0.6
374 0.54
375 0.54
376 0.53
377 0.53
378 0.52
379 0.53
380 0.51
381 0.54
382 0.53
383 0.51
384 0.48
385 0.44
386 0.5
387 0.53
388 0.58
389 0.62
390 0.71
391 0.79
392 0.84
393 0.88
394 0.89
395 0.9
396 0.91
397 0.92
398 0.92
399 0.92
400 0.92
401 0.91
402 0.84
403 0.76
404 0.71
405 0.69
406 0.69
407 0.68
408 0.63
409 0.65
410 0.67
411 0.67
412 0.71
413 0.71
414 0.7
415 0.7
416 0.75
417 0.75
418 0.8
419 0.84
420 0.84
421 0.85
422 0.78
423 0.71
424 0.66
425 0.61
426 0.55
427 0.53
428 0.44
429 0.41