Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A439CP67

Protein Details
Accession A0A439CP67    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-36THYLTADPKPSKKRKRKQANEGLIIAHydrophilic
NLS Segment(s)
PositionSequence
19-27KPSKKRKRK
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MPSDLSSYLATHYLTADPKPSKKRKRKQANEGLIIADDDETGWSRPRGRGDGDDDEEMVMNATVAGTSAEFRKAKKSGWKVLGGSSTTIAPASAQDDASRQADAILAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.22
4 0.26
5 0.33
6 0.43
7 0.53
8 0.6
9 0.7
10 0.79
11 0.83
12 0.89
13 0.92
14 0.93
15 0.93
16 0.92
17 0.86
18 0.77
19 0.66
20 0.55
21 0.44
22 0.33
23 0.22
24 0.12
25 0.06
26 0.05
27 0.06
28 0.06
29 0.08
30 0.09
31 0.11
32 0.13
33 0.16
34 0.18
35 0.19
36 0.22
37 0.26
38 0.3
39 0.3
40 0.28
41 0.25
42 0.23
43 0.2
44 0.17
45 0.11
46 0.06
47 0.03
48 0.03
49 0.03
50 0.02
51 0.02
52 0.03
53 0.03
54 0.04
55 0.05
56 0.1
57 0.11
58 0.12
59 0.18
60 0.2
61 0.24
62 0.34
63 0.41
64 0.45
65 0.5
66 0.54
67 0.49
68 0.51
69 0.51
70 0.42
71 0.36
72 0.28
73 0.22
74 0.17
75 0.16
76 0.12
77 0.08
78 0.08
79 0.09
80 0.09
81 0.09
82 0.1
83 0.11
84 0.15
85 0.16
86 0.15
87 0.13
88 0.12