Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A439DBN1

Protein Details
Accession A0A439DBN1   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
179-201VGEAKPKKEKKEKAPKPQKAPAVBasic
NLS Segment(s)
PositionSequence
182-198AKPKKEKKEKAPKPQKA
Subcellular Location(s) cyto_nucl 13.333, cyto 13, nucl 11.5, mito_nucl 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR012340  NA-bd_OB-fold  
IPR002547  tRNA-bd_dom  
Gene Ontology GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF01588  tRNA_bind  
PROSITE View protein in PROSITE  
PS50886  TRBD  
CDD cd10304  GST_C_Arc1p_N_like  
Amino Acid Sequences MAALEAQKLSSTEETEVQQWITTSERLKSSPADASILEKLNAHLASRTTLLGTKPSKADIAIYESLAPAVKSWSPEQRTGQQGHPHIVRHLDFVQNSDIFDFKVGDDDKVKVDPEEVLYVKPPTDAKAEKERLKKEKAAAAAAAAGGEATLVDRTKAAAQTVVDKAVEAKNAVAAAAGVGEAKPKKEKKEKAPKPQKAPAVTTPPAPHLIDLRVGHILKAIKHPEADSLYVSTIAMGDKPGTEDTEEYEGQVCRTVCSGLNGLVPLEEMQGRKVVVVANLKPVKMRGIKSCAMVLAASPRLKEGEAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.21
5 0.19
6 0.17
7 0.16
8 0.16
9 0.18
10 0.19
11 0.22
12 0.25
13 0.25
14 0.27
15 0.28
16 0.29
17 0.3
18 0.29
19 0.27
20 0.24
21 0.27
22 0.29
23 0.29
24 0.25
25 0.21
26 0.2
27 0.23
28 0.23
29 0.19
30 0.17
31 0.16
32 0.17
33 0.18
34 0.18
35 0.14
36 0.16
37 0.16
38 0.22
39 0.23
40 0.25
41 0.25
42 0.26
43 0.26
44 0.23
45 0.25
46 0.19
47 0.23
48 0.21
49 0.2
50 0.19
51 0.18
52 0.18
53 0.16
54 0.14
55 0.08
56 0.09
57 0.1
58 0.12
59 0.16
60 0.24
61 0.27
62 0.32
63 0.37
64 0.41
65 0.45
66 0.46
67 0.49
68 0.47
69 0.46
70 0.46
71 0.45
72 0.39
73 0.35
74 0.36
75 0.3
76 0.27
77 0.27
78 0.25
79 0.23
80 0.23
81 0.25
82 0.21
83 0.21
84 0.17
85 0.16
86 0.11
87 0.12
88 0.11
89 0.07
90 0.12
91 0.12
92 0.13
93 0.14
94 0.16
95 0.16
96 0.17
97 0.17
98 0.12
99 0.12
100 0.11
101 0.11
102 0.14
103 0.13
104 0.12
105 0.13
106 0.14
107 0.13
108 0.14
109 0.13
110 0.11
111 0.15
112 0.17
113 0.2
114 0.29
115 0.36
116 0.41
117 0.48
118 0.54
119 0.55
120 0.58
121 0.57
122 0.51
123 0.49
124 0.44
125 0.38
126 0.3
127 0.24
128 0.19
129 0.15
130 0.12
131 0.07
132 0.05
133 0.03
134 0.03
135 0.02
136 0.02
137 0.03
138 0.03
139 0.03
140 0.03
141 0.04
142 0.06
143 0.07
144 0.07
145 0.08
146 0.08
147 0.12
148 0.13
149 0.13
150 0.12
151 0.11
152 0.12
153 0.12
154 0.12
155 0.08
156 0.08
157 0.07
158 0.08
159 0.07
160 0.06
161 0.04
162 0.04
163 0.03
164 0.03
165 0.03
166 0.03
167 0.06
168 0.06
169 0.08
170 0.15
171 0.19
172 0.27
173 0.37
174 0.46
175 0.54
176 0.65
177 0.74
178 0.78
179 0.86
180 0.86
181 0.85
182 0.84
183 0.8
184 0.72
185 0.68
186 0.62
187 0.59
188 0.51
189 0.47
190 0.41
191 0.36
192 0.35
193 0.3
194 0.25
195 0.19
196 0.19
197 0.2
198 0.19
199 0.19
200 0.2
201 0.2
202 0.19
203 0.21
204 0.21
205 0.18
206 0.25
207 0.26
208 0.23
209 0.24
210 0.24
211 0.25
212 0.26
213 0.25
214 0.2
215 0.18
216 0.17
217 0.16
218 0.15
219 0.11
220 0.09
221 0.08
222 0.07
223 0.06
224 0.06
225 0.06
226 0.08
227 0.09
228 0.1
229 0.11
230 0.11
231 0.13
232 0.18
233 0.17
234 0.16
235 0.18
236 0.18
237 0.17
238 0.21
239 0.18
240 0.14
241 0.15
242 0.16
243 0.14
244 0.17
245 0.19
246 0.16
247 0.18
248 0.17
249 0.16
250 0.14
251 0.14
252 0.11
253 0.11
254 0.12
255 0.11
256 0.11
257 0.14
258 0.14
259 0.13
260 0.14
261 0.14
262 0.17
263 0.24
264 0.24
265 0.32
266 0.35
267 0.35
268 0.36
269 0.35
270 0.38
271 0.37
272 0.4
273 0.39
274 0.43
275 0.46
276 0.47
277 0.48
278 0.4
279 0.35
280 0.3
281 0.23
282 0.22
283 0.25
284 0.24
285 0.23
286 0.23
287 0.24