Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A439D964

Protein Details
Accession A0A439D964    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-122RAPLARYRPPRPLRRRRAPAPRLRPPDGBasic
NLS Segment(s)
PositionSequence
99-119ARYRPPRPLRRRRAPAPRLRP
Subcellular Location(s) extr 9, plas 7, mito 3, E.R. 3, vacu 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR033118  EXPERA  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF05241  EBP  
PROSITE View protein in PROSITE  
PS51751  EXPERA  
Amino Acid Sequences MASSTRPVLDRVYLVYFLIHIPVMFLVDLVPLYPASLWVPADAPLHALWHLRQYYIENYNDQFFLPPPAEIPSFFPLFAFFELVFHLPVSLWAARAPLARYRPPRPLRRRRAPAPRLRPPDGYHYSHVHVRGRAVGPRRRLVRAEDGPPVLLTADMYSRVLKRVNAADAVKKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.14
5 0.14
6 0.11
7 0.07
8 0.07
9 0.07
10 0.08
11 0.07
12 0.07
13 0.05
14 0.06
15 0.06
16 0.05
17 0.06
18 0.05
19 0.05
20 0.05
21 0.06
22 0.06
23 0.08
24 0.08
25 0.08
26 0.09
27 0.11
28 0.12
29 0.11
30 0.12
31 0.1
32 0.11
33 0.11
34 0.11
35 0.1
36 0.16
37 0.16
38 0.15
39 0.16
40 0.17
41 0.22
42 0.26
43 0.27
44 0.23
45 0.23
46 0.24
47 0.24
48 0.21
49 0.17
50 0.12
51 0.13
52 0.11
53 0.1
54 0.09
55 0.12
56 0.12
57 0.12
58 0.15
59 0.15
60 0.15
61 0.15
62 0.14
63 0.12
64 0.13
65 0.13
66 0.1
67 0.07
68 0.07
69 0.08
70 0.09
71 0.08
72 0.07
73 0.06
74 0.05
75 0.05
76 0.07
77 0.06
78 0.06
79 0.06
80 0.07
81 0.08
82 0.09
83 0.11
84 0.13
85 0.17
86 0.23
87 0.29
88 0.33
89 0.42
90 0.49
91 0.58
92 0.64
93 0.72
94 0.76
95 0.81
96 0.86
97 0.85
98 0.88
99 0.88
100 0.87
101 0.86
102 0.85
103 0.82
104 0.78
105 0.72
106 0.63
107 0.63
108 0.58
109 0.52
110 0.46
111 0.42
112 0.4
113 0.4
114 0.41
115 0.36
116 0.31
117 0.28
118 0.3
119 0.29
120 0.32
121 0.37
122 0.4
123 0.42
124 0.48
125 0.51
126 0.49
127 0.49
128 0.49
129 0.51
130 0.51
131 0.49
132 0.47
133 0.44
134 0.41
135 0.38
136 0.33
137 0.23
138 0.17
139 0.13
140 0.08
141 0.08
142 0.09
143 0.1
144 0.13
145 0.14
146 0.17
147 0.2
148 0.2
149 0.24
150 0.28
151 0.3
152 0.34
153 0.36
154 0.41