Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A439CPS9

Protein Details
Accession A0A439CPS9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
542-566YPTSTPTRRPCISKRRQQSINNKKMHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR003305  CenC_carb-bd  
IPR008979  Galactose-bd-like_sf  
Gene Ontology GO:0110165  C:cellular anatomical entity  
GO:0016798  F:hydrolase activity, acting on glycosyl bonds  
Pfam View protein in Pfam  
PF02018  CBM_4_9  
Amino Acid Sequences MTRQLSIKSLVSAILAAAAAVQVAAQDNCYTEASPNLLVNPSWEDGLDGWTYLYPRSVSTAVHSEGAYSLFTSGVYPAQYAYQTVNNLAVGTEYDFSIDFNIVVPNSLVITENCYVYLYHDSLLTTNLVGTKLASFNRNTNTWQTVSGKYTATSSSTLFGIYLLCSPYRLAQVSIYVDNAVLRAPDTLVCPDPEPESTPEPTLVPTPEPSSIPATTLSSTPPNSYSTPASSSPTPVSSSGLSSVLLSSYPPPSSSYPVSSFPGSSVPPSGSSSAAANSYPAPPSSYPASGNPTPSNPPSATPSSGPSPSPTSSYPLPPSSYPISSYPAPSNTPSATPSSGPSSLPVNSYPAPPSSPPASSYPIPSSNPPATPSSGPSSLPANSYPAIPSDYPVSGYPTPSNTPSATPSSNPSATPSSRPSSSPSAGPSSNLGGSYPVPSSSSPVSHYPALSNTPSASPSLGPSSSGPAGPSSHSGSSYPVSPSSYPVSNYPSPSATPSSTPSSGPSSYPSSAATGSYPSYPSYPSGYPHSSYPHPQSSGGAYPTSTPTRRPCISKRRQQSINNKKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.07
4 0.06
5 0.05
6 0.05
7 0.04
8 0.04
9 0.03
10 0.06
11 0.06
12 0.08
13 0.08
14 0.1
15 0.12
16 0.14
17 0.14
18 0.13
19 0.15
20 0.17
21 0.19
22 0.19
23 0.18
24 0.19
25 0.18
26 0.19
27 0.2
28 0.19
29 0.17
30 0.16
31 0.15
32 0.14
33 0.17
34 0.15
35 0.11
36 0.11
37 0.12
38 0.13
39 0.12
40 0.14
41 0.11
42 0.12
43 0.16
44 0.17
45 0.16
46 0.2
47 0.26
48 0.25
49 0.26
50 0.25
51 0.21
52 0.21
53 0.21
54 0.17
55 0.11
56 0.1
57 0.08
58 0.08
59 0.08
60 0.08
61 0.09
62 0.09
63 0.09
64 0.09
65 0.11
66 0.12
67 0.12
68 0.14
69 0.16
70 0.16
71 0.17
72 0.18
73 0.16
74 0.16
75 0.15
76 0.12
77 0.09
78 0.1
79 0.09
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.07
87 0.07
88 0.09
89 0.08
90 0.09
91 0.09
92 0.08
93 0.08
94 0.08
95 0.09
96 0.07
97 0.12
98 0.13
99 0.13
100 0.13
101 0.13
102 0.13
103 0.14
104 0.18
105 0.14
106 0.14
107 0.14
108 0.15
109 0.14
110 0.15
111 0.13
112 0.09
113 0.09
114 0.1
115 0.09
116 0.09
117 0.09
118 0.1
119 0.13
120 0.15
121 0.17
122 0.18
123 0.23
124 0.27
125 0.28
126 0.29
127 0.31
128 0.32
129 0.3
130 0.32
131 0.31
132 0.31
133 0.31
134 0.31
135 0.27
136 0.23
137 0.24
138 0.2
139 0.19
140 0.17
141 0.15
142 0.13
143 0.13
144 0.13
145 0.11
146 0.1
147 0.09
148 0.08
149 0.09
150 0.08
151 0.08
152 0.09
153 0.09
154 0.11
155 0.14
156 0.14
157 0.13
158 0.13
159 0.16
160 0.18
161 0.19
162 0.17
163 0.14
164 0.13
165 0.12
166 0.11
167 0.08
168 0.06
169 0.05
170 0.05
171 0.05
172 0.06
173 0.08
174 0.1
175 0.11
176 0.12
177 0.13
178 0.13
179 0.14
180 0.14
181 0.16
182 0.17
183 0.19
184 0.19
185 0.19
186 0.19
187 0.18
188 0.18
189 0.17
190 0.15
191 0.13
192 0.13
193 0.14
194 0.15
195 0.15
196 0.16
197 0.18
198 0.16
199 0.16
200 0.16
201 0.15
202 0.14
203 0.14
204 0.14
205 0.14
206 0.15
207 0.15
208 0.15
209 0.17
210 0.17
211 0.19
212 0.19
213 0.18
214 0.2
215 0.2
216 0.21
217 0.19
218 0.2
219 0.19
220 0.19
221 0.18
222 0.15
223 0.16
224 0.14
225 0.14
226 0.13
227 0.12
228 0.1
229 0.09
230 0.09
231 0.07
232 0.06
233 0.06
234 0.06
235 0.08
236 0.08
237 0.08
238 0.11
239 0.12
240 0.16
241 0.17
242 0.19
243 0.2
244 0.22
245 0.24
246 0.21
247 0.2
248 0.17
249 0.17
250 0.14
251 0.12
252 0.11
253 0.1
254 0.11
255 0.12
256 0.12
257 0.1
258 0.1
259 0.1
260 0.1
261 0.1
262 0.08
263 0.08
264 0.08
265 0.08
266 0.08
267 0.08
268 0.09
269 0.09
270 0.11
271 0.13
272 0.13
273 0.14
274 0.15
275 0.2
276 0.19
277 0.22
278 0.21
279 0.21
280 0.22
281 0.22
282 0.23
283 0.18
284 0.18
285 0.2
286 0.21
287 0.21
288 0.19
289 0.21
290 0.2
291 0.21
292 0.2
293 0.18
294 0.19
295 0.18
296 0.2
297 0.18
298 0.19
299 0.2
300 0.23
301 0.24
302 0.22
303 0.23
304 0.2
305 0.24
306 0.23
307 0.22
308 0.21
309 0.19
310 0.21
311 0.2
312 0.22
313 0.2
314 0.2
315 0.21
316 0.2
317 0.21
318 0.18
319 0.18
320 0.17
321 0.17
322 0.16
323 0.15
324 0.16
325 0.17
326 0.17
327 0.16
328 0.16
329 0.16
330 0.15
331 0.16
332 0.15
333 0.15
334 0.15
335 0.16
336 0.17
337 0.15
338 0.16
339 0.15
340 0.18
341 0.17
342 0.17
343 0.18
344 0.2
345 0.23
346 0.22
347 0.25
348 0.26
349 0.27
350 0.27
351 0.27
352 0.29
353 0.28
354 0.28
355 0.27
356 0.26
357 0.25
358 0.24
359 0.26
360 0.24
361 0.23
362 0.22
363 0.21
364 0.21
365 0.2
366 0.2
367 0.18
368 0.16
369 0.15
370 0.15
371 0.14
372 0.13
373 0.15
374 0.13
375 0.13
376 0.13
377 0.13
378 0.14
379 0.14
380 0.19
381 0.17
382 0.19
383 0.2
384 0.2
385 0.22
386 0.22
387 0.24
388 0.2
389 0.2
390 0.22
391 0.25
392 0.23
393 0.22
394 0.25
395 0.28
396 0.28
397 0.27
398 0.27
399 0.28
400 0.28
401 0.31
402 0.32
403 0.31
404 0.31
405 0.32
406 0.33
407 0.35
408 0.35
409 0.33
410 0.31
411 0.32
412 0.31
413 0.31
414 0.27
415 0.23
416 0.22
417 0.19
418 0.16
419 0.13
420 0.13
421 0.14
422 0.13
423 0.11
424 0.12
425 0.12
426 0.15
427 0.16
428 0.16
429 0.18
430 0.2
431 0.23
432 0.24
433 0.24
434 0.23
435 0.23
436 0.26
437 0.24
438 0.22
439 0.19
440 0.19
441 0.19
442 0.18
443 0.16
444 0.13
445 0.14
446 0.17
447 0.16
448 0.16
449 0.16
450 0.2
451 0.2
452 0.2
453 0.18
454 0.16
455 0.17
456 0.17
457 0.2
458 0.19
459 0.19
460 0.2
461 0.2
462 0.21
463 0.21
464 0.22
465 0.21
466 0.18
467 0.21
468 0.2
469 0.23
470 0.24
471 0.26
472 0.24
473 0.25
474 0.31
475 0.32
476 0.34
477 0.34
478 0.31
479 0.3
480 0.32
481 0.33
482 0.28
483 0.27
484 0.28
485 0.31
486 0.31
487 0.3
488 0.3
489 0.31
490 0.3
491 0.29
492 0.29
493 0.28
494 0.28
495 0.28
496 0.26
497 0.23
498 0.23
499 0.22
500 0.19
501 0.16
502 0.16
503 0.17
504 0.17
505 0.16
506 0.17
507 0.18
508 0.19
509 0.22
510 0.22
511 0.23
512 0.3
513 0.32
514 0.33
515 0.34
516 0.38
517 0.38
518 0.43
519 0.48
520 0.48
521 0.46
522 0.45
523 0.44
524 0.44
525 0.45
526 0.4
527 0.33
528 0.25
529 0.25
530 0.3
531 0.35
532 0.32
533 0.33
534 0.38
535 0.46
536 0.51
537 0.57
538 0.62
539 0.65
540 0.75
541 0.79
542 0.82
543 0.83
544 0.87
545 0.89
546 0.9