Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7DRY8

Protein Details
Accession G7DRY8   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-75SSNNRRDSNNRRPNRDREPFHydrophilic
181-203TESTVKNKIKKDKERVRLDQLKIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.833, cyto 3
Family & Domain DBs
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences MDMFFILKINGNNGPPLGPSGNGNRDPSGPPGSQGPPGPHNPNSHLGQDSSNDRDSSNNRRDSNNRRPNRDREPFNPNRDRFNPNRNPFDSYNNRDSFDSYNNGYPYNNGSHYDPNNYNNSSNQVIPGPSNSHSGPSYSHSGPSNSGVVNCSSNSGVVTQSDSFERKVGLFDSLGIKKYDTESTVKNKIKKDKERVRLDQLKIDDPAAYKRLMERRSFANRQGSPGTQWGKELEKAKRNETRMSKMRSRSLDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.22
4 0.19
5 0.15
6 0.18
7 0.24
8 0.31
9 0.34
10 0.36
11 0.34
12 0.35
13 0.36
14 0.38
15 0.36
16 0.29
17 0.26
18 0.29
19 0.3
20 0.31
21 0.32
22 0.32
23 0.31
24 0.37
25 0.42
26 0.41
27 0.44
28 0.44
29 0.47
30 0.45
31 0.43
32 0.38
33 0.33
34 0.3
35 0.29
36 0.29
37 0.28
38 0.27
39 0.25
40 0.23
41 0.27
42 0.31
43 0.37
44 0.41
45 0.45
46 0.44
47 0.5
48 0.58
49 0.63
50 0.69
51 0.7
52 0.69
53 0.7
54 0.76
55 0.78
56 0.8
57 0.8
58 0.75
59 0.7
60 0.73
61 0.72
62 0.74
63 0.76
64 0.67
65 0.65
66 0.63
67 0.65
68 0.6
69 0.62
70 0.63
71 0.6
72 0.66
73 0.6
74 0.62
75 0.57
76 0.6
77 0.58
78 0.53
79 0.55
80 0.48
81 0.48
82 0.42
83 0.42
84 0.36
85 0.3
86 0.27
87 0.2
88 0.22
89 0.21
90 0.22
91 0.19
92 0.18
93 0.17
94 0.17
95 0.16
96 0.14
97 0.16
98 0.2
99 0.21
100 0.26
101 0.25
102 0.25
103 0.28
104 0.28
105 0.27
106 0.23
107 0.24
108 0.21
109 0.18
110 0.16
111 0.13
112 0.12
113 0.12
114 0.12
115 0.11
116 0.11
117 0.14
118 0.13
119 0.14
120 0.14
121 0.14
122 0.14
123 0.15
124 0.18
125 0.16
126 0.18
127 0.17
128 0.18
129 0.18
130 0.19
131 0.17
132 0.13
133 0.13
134 0.12
135 0.12
136 0.12
137 0.11
138 0.11
139 0.09
140 0.09
141 0.09
142 0.09
143 0.08
144 0.07
145 0.1
146 0.09
147 0.09
148 0.11
149 0.13
150 0.13
151 0.13
152 0.13
153 0.11
154 0.12
155 0.12
156 0.11
157 0.1
158 0.11
159 0.16
160 0.17
161 0.18
162 0.18
163 0.17
164 0.16
165 0.19
166 0.19
167 0.16
168 0.17
169 0.21
170 0.27
171 0.37
172 0.42
173 0.45
174 0.5
175 0.58
176 0.65
177 0.7
178 0.75
179 0.75
180 0.8
181 0.84
182 0.84
183 0.85
184 0.83
185 0.76
186 0.71
187 0.64
188 0.58
189 0.49
190 0.43
191 0.34
192 0.26
193 0.28
194 0.24
195 0.21
196 0.18
197 0.23
198 0.31
199 0.34
200 0.35
201 0.34
202 0.41
203 0.5
204 0.54
205 0.54
206 0.57
207 0.53
208 0.55
209 0.56
210 0.5
211 0.43
212 0.47
213 0.44
214 0.35
215 0.35
216 0.33
217 0.32
218 0.36
219 0.4
220 0.42
221 0.46
222 0.5
223 0.57
224 0.62
225 0.62
226 0.66
227 0.67
228 0.68
229 0.69
230 0.73
231 0.73
232 0.72
233 0.77