Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A439D3H2

Protein Details
Accession A0A439D3H2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-99EPEFEWVRKKERRKSRSRSPAPAILTHydrophilic
NLS Segment(s)
PositionSequence
80-92VRKKERRKSRSRS
Subcellular Location(s) nucl 17.5, cyto_nucl 12, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MARRHLSLETLRVYNIDYVLDQDPEYVLIKRWVPEPEQDILWRHTRVVREQRTNSRLVLAIEDGKKKHHHHHLEPEFEWVRKKERRKSRSRSPAPAILTYLAGGRPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.15
4 0.1
5 0.13
6 0.14
7 0.14
8 0.13
9 0.12
10 0.11
11 0.12
12 0.13
13 0.1
14 0.1
15 0.13
16 0.14
17 0.15
18 0.18
19 0.19
20 0.2
21 0.23
22 0.25
23 0.23
24 0.23
25 0.24
26 0.23
27 0.24
28 0.26
29 0.22
30 0.2
31 0.21
32 0.22
33 0.28
34 0.36
35 0.4
36 0.44
37 0.49
38 0.57
39 0.57
40 0.56
41 0.48
42 0.39
43 0.33
44 0.25
45 0.21
46 0.14
47 0.15
48 0.16
49 0.19
50 0.18
51 0.19
52 0.25
53 0.27
54 0.34
55 0.39
56 0.45
57 0.49
58 0.6
59 0.64
60 0.65
61 0.62
62 0.62
63 0.54
64 0.47
65 0.44
66 0.35
67 0.37
68 0.39
69 0.48
70 0.51
71 0.6
72 0.69
73 0.75
74 0.82
75 0.85
76 0.88
77 0.89
78 0.88
79 0.84
80 0.82
81 0.75
82 0.68
83 0.6
84 0.49
85 0.41
86 0.31
87 0.26