Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7XV61

Protein Details
Accession G7XV61    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
87-107APLKRVPTPYPKKNKGQYDDDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 12.833, cyto_nucl 12.166, mito 4
Family & Domain DBs
Amino Acid Sequences MDKIVSFSNWLKVVKAKSQPVASMYASTSNGDDNEPPKKRQKVSHHSPFAVDGVVEGSTTQDDEQNICVIEGEVVEFMGIDDYEFGAPLKRVPTPYPKKNKGQYDDDDEDEEGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.43
4 0.45
5 0.47
6 0.47
7 0.43
8 0.43
9 0.35
10 0.29
11 0.24
12 0.22
13 0.2
14 0.19
15 0.17
16 0.14
17 0.14
18 0.13
19 0.14
20 0.14
21 0.23
22 0.26
23 0.29
24 0.37
25 0.43
26 0.46
27 0.54
28 0.61
29 0.62
30 0.69
31 0.76
32 0.73
33 0.67
34 0.63
35 0.54
36 0.44
37 0.34
38 0.23
39 0.12
40 0.07
41 0.06
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.06
51 0.07
52 0.08
53 0.08
54 0.08
55 0.07
56 0.06
57 0.06
58 0.05
59 0.05
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.07
75 0.09
76 0.11
77 0.13
78 0.16
79 0.2
80 0.31
81 0.4
82 0.5
83 0.59
84 0.65
85 0.72
86 0.79
87 0.84
88 0.8
89 0.79
90 0.75
91 0.73
92 0.7
93 0.63
94 0.56