Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A439CVM2

Protein Details
Accession A0A439CVM2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
74-96EVNSALRVPKRQKKNARKSRRTRHydrophilic
NLS Segment(s)
PositionSequence
81-96VPKRQKKNARKSRRTR
Subcellular Location(s) nucl 17, cyto 7, mito 1, cysk 1, vacu 1
Family & Domain DBs
Amino Acid Sequences EEFKGKPLKQPCEDATVDAGADEEEAPQARPRWQPEEPEEQLEELDNKVPKKRRYTGEPTFVLDADGNEAYTMEVNSALRVPKRQKKNARKSRRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.4
3 0.31
4 0.26
5 0.19
6 0.16
7 0.09
8 0.09
9 0.07
10 0.05
11 0.05
12 0.06
13 0.07
14 0.1
15 0.12
16 0.16
17 0.21
18 0.25
19 0.31
20 0.33
21 0.37
22 0.4
23 0.47
24 0.44
25 0.42
26 0.38
27 0.32
28 0.29
29 0.24
30 0.19
31 0.11
32 0.12
33 0.12
34 0.12
35 0.17
36 0.24
37 0.29
38 0.36
39 0.42
40 0.44
41 0.5
42 0.59
43 0.61
44 0.63
45 0.59
46 0.54
47 0.48
48 0.43
49 0.35
50 0.26
51 0.18
52 0.13
53 0.11
54 0.09
55 0.08
56 0.08
57 0.07
58 0.07
59 0.07
60 0.05
61 0.06
62 0.06
63 0.07
64 0.09
65 0.12
66 0.14
67 0.22
68 0.31
69 0.4
70 0.5
71 0.6
72 0.69
73 0.78
74 0.87
75 0.9
76 0.92