FuNGI

A0A421JVU5

Protein Details

Accession

A0A421JVU5

Localization Confidence

High

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
2-25	NTELPPLNKIHKKKSNQSIRFVTF	Hydrophilic
436-467	KEQPVKSKIKYVSHKIEKAKKDKQKSIDRFFS	Hydrophilic

NLS Segment(s)

Position	Sequence
453-456	KAKK

Subcellular Location(s)

nucl 18.5, cyto_nucl 12, mito 4, cyto 2.5

Family & Domain DBs

InterPro	View protein in InterPro IPR004808 AP_endonuc_1 IPR020848 AP_endonuclease_F1_CS IPR036691 Endo/exonu/phosph_ase_sf IPR005135 Endo/exonuclease/phosphatase
Gene Ontology	GO:0003677 F:DNA binding GO:0004519 F:endonuclease activity GO:0006281 P:DNA repair
Pfam	View protein in Pfam PF03372 Exo_endo_phos
PROSITE	View protein in PROSITE PS00728 AP_NUCLEASE_F1_3 PS51435 AP_NUCLEASE_F1_4

Amino Acid Sequences

MNTELPPLNKIHKKKSNQSIRFVTFNVNGAKTLFNYHPWTYFNHDYNSVFNSLQADIITLQELKLSRTNLHTIKNIGHLKNYRSFITLPKTKKGYSGVGLFVRIPESNESTSVKKCLSVIKAEEGITGWLCPRDSTVPYREMEQSIGGYIDIDSQQGLNLDSEGRCVCVEFANNLVVFALYCPANSMDTEEGEQFRLNFISLLLERCYNLKFMGKEVIIMGDINIATDLIDHAQSIEDMTHSSSIKNFEMVNYEECCEFKNSTLARSLLNKYVIPGLWHDLTATNPQQDTNKQFLYDTTRFIQGRRMKMYTVWNTLTNSRAINFGSRIDLILTSSYNMMKSISQADIWEFILGSDHCPVFTDFESDCFIDEEEEIPAIQKIPFEAKYHYKLFKNRDISSLFASRKPSSPSPEQTDTTPSSDSANNSESSSQLEEPKEQPVKSKIKYVSHKIEKAKKDKQKSIDRFFS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.75
2	0.83
3	0.85
4	0.83
5	0.85
6	0.84
7	0.79
8	0.73
9	0.64
10	0.6
11	0.51
12	0.49
13	0.45
14	0.36
15	0.32
16	0.3
17	0.3
18	0.24
19	0.26
20	0.23
21	0.23
22	0.28
23	0.3
24	0.32
25	0.31
26	0.35
27	0.38
28	0.43
29	0.42
30	0.4
31	0.42
32	0.39
33	0.41
34	0.4
35	0.35
36	0.27
37	0.24
38	0.22
39	0.19
40	0.18
41	0.15
42	0.13
43	0.11
44	0.11
45	0.12
46	0.1
47	0.09
48	0.11
49	0.12
50	0.14
51	0.18
52	0.2
53	0.21
54	0.25
55	0.33
56	0.34
57	0.38
58	0.39
59	0.37
60	0.38
61	0.45
62	0.48
63	0.42
64	0.46
65	0.46
66	0.47
67	0.52
68	0.52
69	0.44
70	0.39
71	0.4
72	0.38
73	0.43
74	0.46
75	0.42
76	0.47
77	0.51
78	0.48
79	0.52
80	0.49
81	0.45
82	0.42
83	0.41
84	0.38
85	0.35
86	0.35
87	0.31
88	0.27
89	0.23
90	0.19
91	0.17
92	0.15
93	0.18
94	0.18
95	0.2
96	0.22
97	0.23
98	0.25
99	0.26
100	0.23
101	0.21
102	0.21
103	0.25
104	0.26
105	0.28
106	0.29
107	0.31
108	0.33
109	0.32
110	0.31
111	0.25
112	0.23
113	0.17
114	0.15
115	0.11
116	0.1
117	0.1
118	0.09
119	0.11
120	0.13
121	0.16
122	0.21
123	0.25
124	0.27
125	0.27
126	0.31
127	0.3
128	0.28
129	0.26
130	0.22
131	0.17
132	0.14
133	0.13
134	0.1
135	0.08
136	0.07
137	0.08
138	0.07
139	0.07
140	0.06
141	0.06
142	0.07
143	0.07
144	0.07
145	0.06
146	0.06
147	0.08
148	0.07
149	0.09
150	0.09
151	0.1
152	0.09
153	0.09
154	0.09
155	0.09
156	0.1
157	0.09
158	0.11
159	0.12
160	0.12
161	0.12
162	0.11
163	0.09
164	0.08
165	0.07
166	0.07
167	0.05
168	0.05
169	0.06
170	0.07
171	0.07
172	0.07
173	0.1
174	0.09
175	0.09
176	0.11
177	0.11
178	0.11
179	0.11
180	0.12
181	0.09
182	0.09
183	0.09
184	0.08
185	0.07
186	0.06
187	0.08
188	0.08
189	0.1
190	0.1
191	0.1
192	0.1
193	0.12
194	0.12
195	0.1
196	0.1
197	0.12
198	0.12
199	0.13
200	0.17
201	0.16
202	0.16
203	0.15
204	0.15
205	0.11
206	0.11
207	0.09
208	0.05
209	0.05
210	0.05
211	0.05
212	0.04
213	0.03
214	0.04
215	0.04
216	0.03
217	0.03
218	0.03
219	0.04
220	0.04
221	0.04
222	0.04
223	0.04
224	0.04
225	0.04
226	0.05
227	0.07
228	0.07
229	0.07
230	0.09
231	0.12
232	0.12
233	0.13
234	0.12
235	0.11
236	0.14
237	0.15
238	0.16
239	0.14
240	0.15
241	0.14
242	0.14
243	0.15
244	0.14
245	0.13
246	0.11
247	0.17
248	0.16
249	0.17
250	0.21
251	0.2
252	0.19
253	0.23
254	0.25
255	0.22
256	0.24
257	0.22
258	0.2
259	0.21
260	0.2
261	0.16
262	0.15
263	0.15
264	0.13
265	0.13
266	0.13
267	0.11
268	0.12
269	0.16
270	0.16
271	0.15
272	0.15
273	0.16
274	0.18
275	0.22
276	0.25
277	0.25
278	0.24
279	0.23
280	0.23
281	0.24
282	0.3
283	0.28
284	0.26
285	0.23
286	0.28
287	0.28
288	0.29
289	0.36
290	0.33
291	0.38
292	0.4
293	0.4
294	0.34
295	0.38
296	0.47
297	0.44
298	0.43
299	0.38
300	0.36
301	0.36
302	0.37
303	0.35
304	0.27
305	0.22
306	0.17
307	0.16
308	0.15
309	0.16
310	0.15
311	0.15
312	0.15
313	0.14
314	0.14
315	0.13
316	0.13
317	0.11
318	0.1
319	0.1
320	0.08
321	0.09
322	0.1
323	0.09
324	0.09
325	0.09
326	0.09
327	0.1
328	0.13
329	0.12
330	0.12
331	0.13
332	0.13
333	0.14
334	0.14
335	0.13
336	0.09
337	0.08
338	0.11
339	0.11
340	0.11
341	0.13
342	0.12
343	0.12
344	0.13
345	0.14
346	0.14
347	0.15
348	0.17
349	0.14
350	0.16
351	0.19
352	0.17
353	0.17
354	0.15
355	0.14
356	0.11
357	0.12
358	0.11
359	0.09
360	0.09
361	0.08
362	0.08
363	0.08
364	0.09
365	0.09
366	0.08
367	0.09
368	0.14
369	0.17
370	0.19
371	0.25
372	0.3
373	0.36
374	0.42
375	0.47
376	0.48
377	0.54
378	0.59
379	0.63
380	0.64
381	0.6
382	0.6
383	0.56
384	0.52
385	0.49
386	0.5
387	0.43
388	0.38
389	0.42
390	0.38
391	0.4
392	0.44
393	0.45
394	0.44
395	0.5
396	0.54
397	0.57
398	0.6
399	0.58
400	0.53
401	0.54
402	0.5
403	0.44
404	0.37
405	0.29
406	0.26
407	0.28
408	0.28
409	0.26
410	0.25
411	0.23
412	0.24
413	0.24
414	0.21
415	0.22
416	0.24
417	0.21
418	0.24
419	0.26
420	0.29
421	0.3
422	0.39
423	0.41
424	0.38
425	0.43
426	0.47
427	0.54
428	0.52
429	0.59
430	0.58
431	0.62
432	0.7
433	0.73
434	0.75
435	0.75
436	0.8
437	0.81
438	0.83
439	0.83
440	0.84
441	0.85
442	0.84
443	0.85
444	0.86
445	0.86
446	0.88
447	0.88

A0A421JVU5

3D AlphaFold-predicted Structure Viewer