Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JPG0

Protein Details
Accession A0A421JPG0   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
30-54TYTNVSKKSSNKKSKEPITKPRHAIHydrophilic
141-160SAASSTAASKKKNKKKKKKNHydrophilic
NLS Segment(s)
PositionSequence
149-160SKKKNKKKKKKN
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MPKVSNIESFIELASELYSTYPTTTTLSITYTNVSKKSSNKKSKEPITKPRHAIATHSVNFKLYEPSSGKCIKYNTFKIKELSRILNFVGPRGVNDGGNSHVVGLASLMTNVKYDAVEDETTPAPEGTPEVTSGAASTGTSAASSTAASKKKNKKKKKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.07
3 0.06
4 0.06
5 0.07
6 0.07
7 0.08
8 0.08
9 0.09
10 0.11
11 0.12
12 0.13
13 0.12
14 0.14
15 0.15
16 0.15
17 0.16
18 0.18
19 0.2
20 0.21
21 0.23
22 0.25
23 0.32
24 0.42
25 0.51
26 0.57
27 0.6
28 0.68
29 0.75
30 0.81
31 0.84
32 0.82
33 0.82
34 0.81
35 0.83
36 0.77
37 0.71
38 0.67
39 0.56
40 0.5
41 0.47
42 0.46
43 0.41
44 0.4
45 0.36
46 0.31
47 0.32
48 0.29
49 0.25
50 0.17
51 0.18
52 0.18
53 0.18
54 0.22
55 0.25
56 0.25
57 0.24
58 0.26
59 0.26
60 0.32
61 0.39
62 0.44
63 0.45
64 0.47
65 0.46
66 0.46
67 0.47
68 0.42
69 0.39
70 0.31
71 0.28
72 0.26
73 0.26
74 0.23
75 0.18
76 0.17
77 0.12
78 0.12
79 0.14
80 0.14
81 0.11
82 0.12
83 0.12
84 0.11
85 0.12
86 0.12
87 0.08
88 0.08
89 0.08
90 0.07
91 0.06
92 0.05
93 0.04
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.05
101 0.06
102 0.07
103 0.1
104 0.11
105 0.11
106 0.13
107 0.14
108 0.14
109 0.15
110 0.13
111 0.09
112 0.09
113 0.1
114 0.09
115 0.09
116 0.09
117 0.09
118 0.09
119 0.09
120 0.09
121 0.09
122 0.07
123 0.06
124 0.07
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.07
132 0.1
133 0.16
134 0.21
135 0.27
136 0.37
137 0.47
138 0.58
139 0.69
140 0.77