Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JIG4

Protein Details
Accession A0A421JIG4   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-75SKFRSKDGCLNCRKRRKKCDETMPICYAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MFSVLDAKSLAKTNRKNSASKAQYLVVAKEEKVGFEQKPIKLNNIVNSKFRSKDGCLNCRKRRKKCDETMPICYACEYRNLQCAWPKHVQDRASDAPVDTSEKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.59
4 0.6
5 0.65
6 0.61
7 0.57
8 0.53
9 0.44
10 0.44
11 0.42
12 0.37
13 0.3
14 0.26
15 0.22
16 0.24
17 0.22
18 0.18
19 0.19
20 0.22
21 0.18
22 0.23
23 0.29
24 0.27
25 0.33
26 0.33
27 0.34
28 0.36
29 0.38
30 0.38
31 0.4
32 0.4
33 0.37
34 0.39
35 0.39
36 0.35
37 0.34
38 0.3
39 0.24
40 0.31
41 0.35
42 0.41
43 0.47
44 0.57
45 0.64
46 0.72
47 0.79
48 0.81
49 0.85
50 0.86
51 0.86
52 0.86
53 0.88
54 0.88
55 0.84
56 0.82
57 0.75
58 0.65
59 0.55
60 0.46
61 0.36
62 0.25
63 0.25
64 0.21
65 0.19
66 0.25
67 0.26
68 0.28
69 0.33
70 0.36
71 0.37
72 0.42
73 0.43
74 0.44
75 0.5
76 0.49
77 0.46
78 0.51
79 0.49
80 0.45
81 0.41
82 0.35
83 0.31
84 0.3