Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JLQ3

Protein Details
Accession A0A421JLQ3    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
109-135DAYRECKKDFFAKKKKDRLEGKHGWGFBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 10, mito 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MGESSDSNETSSTSPSVTAKTLKRQTQIANDFSDDTVVKDKSQINFTQGDNPDKFKFYPDNPESHRHKYKWSMKEPSKFYDPCEESRMASMHCLWRNQDDKYACQEFFDAYRECKKDFFAKKKKDRLEGKHGWGFWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.17
4 0.18
5 0.24
6 0.26
7 0.35
8 0.43
9 0.47
10 0.49
11 0.52
12 0.55
13 0.58
14 0.6
15 0.53
16 0.47
17 0.43
18 0.41
19 0.35
20 0.31
21 0.21
22 0.16
23 0.18
24 0.16
25 0.14
26 0.18
27 0.22
28 0.22
29 0.26
30 0.26
31 0.24
32 0.27
33 0.27
34 0.31
35 0.3
36 0.33
37 0.31
38 0.33
39 0.32
40 0.31
41 0.3
42 0.25
43 0.26
44 0.22
45 0.31
46 0.29
47 0.34
48 0.36
49 0.44
50 0.46
51 0.5
52 0.55
53 0.45
54 0.48
55 0.52
56 0.57
57 0.58
58 0.6
59 0.62
60 0.62
61 0.69
62 0.68
63 0.63
64 0.6
65 0.52
66 0.46
67 0.46
68 0.42
69 0.37
70 0.37
71 0.34
72 0.27
73 0.29
74 0.28
75 0.19
76 0.18
77 0.18
78 0.2
79 0.22
80 0.23
81 0.23
82 0.28
83 0.32
84 0.32
85 0.37
86 0.32
87 0.33
88 0.38
89 0.41
90 0.34
91 0.31
92 0.3
93 0.24
94 0.23
95 0.25
96 0.19
97 0.19
98 0.28
99 0.29
100 0.3
101 0.3
102 0.32
103 0.37
104 0.46
105 0.53
106 0.56
107 0.65
108 0.74
109 0.83
110 0.87
111 0.87
112 0.87
113 0.85
114 0.85
115 0.83
116 0.81
117 0.78