Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JPE5

Protein Details
Accession A0A421JPE5   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
172-200IDPRTLNRAERKKLVKKNELQHKRNLKNQHydrophilic
NLS Segment(s)
PositionSequence
101-126KAIPKAKPPTKWEQFAARKGIKAKAK
182-188RKKLVKK
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSKETEYKPVTVDKPIPNTYDLGNLATFDPNPLDNTILKNDNEREQYLTSVTRDNVQLLINQILSLPVKTTTDTQGSSTGQNSTMTLIQLPEPTTQLPREKAIPKAKPPTKWEQFAARKGIKAKAKDGKMVYDEATGEWVPKWGYKGKNKELDNQWLVEVDDKVKNTSDELIDPRTLNRAERKKLVKKNELQHKRNLKNQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.49
4 0.43
5 0.42
6 0.36
7 0.34
8 0.28
9 0.23
10 0.19
11 0.18
12 0.18
13 0.18
14 0.17
15 0.13
16 0.13
17 0.12
18 0.13
19 0.14
20 0.15
21 0.14
22 0.17
23 0.21
24 0.23
25 0.23
26 0.27
27 0.28
28 0.32
29 0.34
30 0.33
31 0.32
32 0.29
33 0.29
34 0.26
35 0.26
36 0.21
37 0.21
38 0.2
39 0.19
40 0.19
41 0.18
42 0.17
43 0.16
44 0.16
45 0.14
46 0.16
47 0.13
48 0.12
49 0.11
50 0.11
51 0.11
52 0.09
53 0.08
54 0.07
55 0.08
56 0.09
57 0.11
58 0.13
59 0.15
60 0.15
61 0.16
62 0.18
63 0.19
64 0.19
65 0.18
66 0.16
67 0.14
68 0.14
69 0.12
70 0.11
71 0.1
72 0.09
73 0.09
74 0.08
75 0.08
76 0.09
77 0.1
78 0.1
79 0.1
80 0.1
81 0.12
82 0.14
83 0.16
84 0.16
85 0.16
86 0.21
87 0.22
88 0.29
89 0.36
90 0.38
91 0.41
92 0.5
93 0.53
94 0.54
95 0.57
96 0.59
97 0.56
98 0.55
99 0.51
100 0.51
101 0.53
102 0.52
103 0.54
104 0.45
105 0.42
106 0.42
107 0.46
108 0.41
109 0.38
110 0.41
111 0.41
112 0.42
113 0.45
114 0.43
115 0.4
116 0.36
117 0.35
118 0.29
119 0.22
120 0.2
121 0.15
122 0.16
123 0.12
124 0.11
125 0.1
126 0.1
127 0.09
128 0.1
129 0.13
130 0.17
131 0.25
132 0.34
133 0.43
134 0.5
135 0.58
136 0.59
137 0.66
138 0.65
139 0.67
140 0.6
141 0.51
142 0.43
143 0.36
144 0.34
145 0.27
146 0.22
147 0.16
148 0.17
149 0.17
150 0.18
151 0.19
152 0.19
153 0.18
154 0.2
155 0.18
156 0.19
157 0.22
158 0.24
159 0.25
160 0.25
161 0.24
162 0.27
163 0.27
164 0.28
165 0.35
166 0.4
167 0.45
168 0.53
169 0.63
170 0.67
171 0.75
172 0.8
173 0.81
174 0.8
175 0.84
176 0.86
177 0.87
178 0.81
179 0.83
180 0.83
181 0.81