Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JHV8

Protein Details
Accession A0A421JHV8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21RSTAVRLVRQRRPTRNESPLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008381  SDHAF3/Sdh7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
CDD cd20270  Complex1_LYR_SDHAF3_LYRM10  
Amino Acid Sequences MRSTAVRLVRQRRPTRNESPLLPPLVLYRGILRAHVHKLPKDLRALGDHYVKDEFKAHKKIDNPLHIVAFLTQWQDYLRQIDHGAWLHNKLKSEELEKMSPEQIGQLYELMKAAKRIGEGEEEQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.76
5 0.69
6 0.67
7 0.62
8 0.57
9 0.48
10 0.39
11 0.31
12 0.28
13 0.25
14 0.18
15 0.14
16 0.16
17 0.16
18 0.18
19 0.18
20 0.2
21 0.24
22 0.28
23 0.31
24 0.28
25 0.35
26 0.37
27 0.39
28 0.38
29 0.35
30 0.32
31 0.31
32 0.32
33 0.28
34 0.29
35 0.25
36 0.23
37 0.24
38 0.21
39 0.19
40 0.21
41 0.22
42 0.24
43 0.31
44 0.3
45 0.32
46 0.35
47 0.41
48 0.44
49 0.45
50 0.42
51 0.37
52 0.36
53 0.32
54 0.29
55 0.22
56 0.15
57 0.11
58 0.09
59 0.07
60 0.07
61 0.08
62 0.09
63 0.09
64 0.11
65 0.11
66 0.11
67 0.12
68 0.12
69 0.15
70 0.15
71 0.16
72 0.16
73 0.2
74 0.23
75 0.24
76 0.25
77 0.23
78 0.26
79 0.26
80 0.28
81 0.3
82 0.31
83 0.32
84 0.31
85 0.33
86 0.3
87 0.28
88 0.23
89 0.19
90 0.16
91 0.14
92 0.14
93 0.13
94 0.12
95 0.12
96 0.13
97 0.12
98 0.13
99 0.13
100 0.14
101 0.15
102 0.15
103 0.17
104 0.18
105 0.23