Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JP73

Protein Details
Accession A0A421JP73   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
172-198ENFVGRRKSKRSILKSLKLKRNNSIRSHydrophilic
NLS Segment(s)
PositionSequence
177-193RRKSKRSILKSLKLKRN
Subcellular Location(s) nucl 23, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MLNYNYSLNQAQSKTSFTSTSTPSQTPTITTTSPNSLSGPFINSNSPRLHRRSNSVDFTNKTSAASMNSNYTPPSSPTSMTRSSNATIGRKRSIIIDLDKVTEEYKNCERRLSVASVKQQPKRGEEDDEVDTDAEFYMRELELSCQLPLSSELLLQSYCRDEDKNEQSSEDENFVGRRKSKRSILKSLKLKRNNSIRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.27
4 0.24
5 0.28
6 0.29
7 0.33
8 0.35
9 0.33
10 0.33
11 0.35
12 0.32
13 0.29
14 0.28
15 0.26
16 0.22
17 0.24
18 0.25
19 0.27
20 0.28
21 0.27
22 0.25
23 0.21
24 0.22
25 0.21
26 0.22
27 0.19
28 0.19
29 0.23
30 0.23
31 0.26
32 0.28
33 0.32
34 0.34
35 0.37
36 0.44
37 0.42
38 0.48
39 0.53
40 0.56
41 0.58
42 0.57
43 0.57
44 0.51
45 0.53
46 0.48
47 0.4
48 0.32
49 0.27
50 0.23
51 0.2
52 0.2
53 0.16
54 0.16
55 0.17
56 0.17
57 0.17
58 0.17
59 0.15
60 0.15
61 0.18
62 0.16
63 0.16
64 0.19
65 0.24
66 0.26
67 0.27
68 0.26
69 0.25
70 0.24
71 0.27
72 0.27
73 0.27
74 0.27
75 0.29
76 0.3
77 0.27
78 0.27
79 0.24
80 0.23
81 0.21
82 0.19
83 0.2
84 0.18
85 0.19
86 0.18
87 0.17
88 0.16
89 0.14
90 0.13
91 0.13
92 0.2
93 0.26
94 0.26
95 0.27
96 0.26
97 0.28
98 0.31
99 0.31
100 0.29
101 0.28
102 0.34
103 0.42
104 0.48
105 0.5
106 0.53
107 0.51
108 0.49
109 0.5
110 0.46
111 0.42
112 0.37
113 0.37
114 0.32
115 0.3
116 0.27
117 0.21
118 0.18
119 0.13
120 0.11
121 0.07
122 0.05
123 0.04
124 0.05
125 0.05
126 0.06
127 0.06
128 0.08
129 0.12
130 0.13
131 0.13
132 0.12
133 0.12
134 0.12
135 0.13
136 0.13
137 0.09
138 0.09
139 0.09
140 0.1
141 0.1
142 0.09
143 0.1
144 0.11
145 0.11
146 0.13
147 0.13
148 0.16
149 0.25
150 0.33
151 0.38
152 0.36
153 0.36
154 0.36
155 0.38
156 0.37
157 0.3
158 0.22
159 0.17
160 0.18
161 0.21
162 0.25
163 0.29
164 0.33
165 0.38
166 0.46
167 0.54
168 0.62
169 0.67
170 0.73
171 0.77
172 0.8
173 0.84
174 0.87
175 0.88
176 0.87
177 0.84
178 0.82