Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JTS3

Protein Details
Accession A0A421JTS3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
100-126NSEIGKKTFSKRSKKREEQGRISKPELHydrophilic
NLS Segment(s)
PositionSequence
106-123KTFSKRSKKREEQGRISK
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MPPRSHRESASESESSRNNTIPGGSSNSGSKSTQKAKNQAAQAIQQNYLARHITSNGPQDRAVVHPLDFEAFDDSVLMRYNEKYGLNLPRPETVNYDILNSEIGKKTFSKRSKKREEQGRISKPELAKHLKSHFMALGSKENEIITGFLYKVKHQDNDFKLTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.36
4 0.32
5 0.26
6 0.24
7 0.24
8 0.22
9 0.21
10 0.23
11 0.21
12 0.21
13 0.23
14 0.24
15 0.26
16 0.24
17 0.25
18 0.26
19 0.34
20 0.41
21 0.46
22 0.53
23 0.57
24 0.63
25 0.63
26 0.59
27 0.53
28 0.5
29 0.5
30 0.43
31 0.37
32 0.33
33 0.31
34 0.27
35 0.27
36 0.23
37 0.16
38 0.14
39 0.15
40 0.16
41 0.19
42 0.26
43 0.26
44 0.27
45 0.26
46 0.26
47 0.26
48 0.24
49 0.22
50 0.15
51 0.13
52 0.11
53 0.11
54 0.11
55 0.1
56 0.09
57 0.08
58 0.07
59 0.07
60 0.07
61 0.06
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.07
68 0.09
69 0.09
70 0.09
71 0.13
72 0.19
73 0.22
74 0.24
75 0.25
76 0.26
77 0.28
78 0.29
79 0.28
80 0.24
81 0.24
82 0.22
83 0.21
84 0.18
85 0.16
86 0.16
87 0.13
88 0.12
89 0.12
90 0.12
91 0.12
92 0.14
93 0.19
94 0.28
95 0.36
96 0.45
97 0.52
98 0.63
99 0.73
100 0.8
101 0.85
102 0.86
103 0.87
104 0.87
105 0.88
106 0.86
107 0.81
108 0.73
109 0.69
110 0.6
111 0.55
112 0.52
113 0.49
114 0.43
115 0.44
116 0.47
117 0.48
118 0.47
119 0.45
120 0.38
121 0.34
122 0.33
123 0.29
124 0.33
125 0.28
126 0.28
127 0.26
128 0.24
129 0.21
130 0.19
131 0.17
132 0.1
133 0.1
134 0.1
135 0.13
136 0.15
137 0.16
138 0.23
139 0.28
140 0.33
141 0.35
142 0.45
143 0.47