Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JK55

Protein Details
Accession A0A421JK55    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
23-43PDSSTRKKNKWVDFKAQKSPYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16.5, cyto_nucl 12, nucl 6.5, pero 2
Family & Domain DBs
Pfam View protein in Pfam  
PF13455  MUG113  
Amino Acid Sequences MYTFKNFVSESIEPWSFKVQNLPDSSTRKKNKWVDFKAQKSPYILVKIGMTTKTVGTRLKEWENKCHHKLVNLGPMNRHLVLDQESSSVKALISGFLGLHITKQATSNDIAAYRRYKQEGFYCQENLDSVEKRIHQSLRHTYGAGDVYCKGCAPTTPTVKVKGGRAPFPVYNTHKEFFLIPKKDIDSIYELIDSICVKYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.35
3 0.28
4 0.28
5 0.33
6 0.31
7 0.35
8 0.39
9 0.42
10 0.42
11 0.48
12 0.54
13 0.56
14 0.6
15 0.57
16 0.64
17 0.68
18 0.71
19 0.75
20 0.76
21 0.77
22 0.8
23 0.82
24 0.83
25 0.77
26 0.7
27 0.62
28 0.57
29 0.51
30 0.45
31 0.39
32 0.3
33 0.26
34 0.25
35 0.25
36 0.22
37 0.18
38 0.14
39 0.15
40 0.16
41 0.18
42 0.19
43 0.19
44 0.22
45 0.27
46 0.34
47 0.4
48 0.41
49 0.47
50 0.54
51 0.59
52 0.59
53 0.6
54 0.53
55 0.49
56 0.52
57 0.49
58 0.49
59 0.45
60 0.43
61 0.38
62 0.39
63 0.39
64 0.34
65 0.27
66 0.17
67 0.14
68 0.16
69 0.16
70 0.13
71 0.12
72 0.12
73 0.12
74 0.12
75 0.11
76 0.08
77 0.08
78 0.08
79 0.07
80 0.07
81 0.07
82 0.06
83 0.06
84 0.07
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.07
91 0.07
92 0.08
93 0.09
94 0.1
95 0.1
96 0.12
97 0.12
98 0.13
99 0.15
100 0.16
101 0.18
102 0.2
103 0.2
104 0.22
105 0.27
106 0.32
107 0.34
108 0.35
109 0.34
110 0.32
111 0.31
112 0.28
113 0.24
114 0.2
115 0.17
116 0.15
117 0.17
118 0.18
119 0.2
120 0.24
121 0.24
122 0.24
123 0.3
124 0.38
125 0.41
126 0.41
127 0.39
128 0.35
129 0.35
130 0.35
131 0.27
132 0.2
133 0.16
134 0.15
135 0.15
136 0.15
137 0.12
138 0.1
139 0.11
140 0.15
141 0.22
142 0.27
143 0.33
144 0.36
145 0.4
146 0.43
147 0.45
148 0.44
149 0.44
150 0.42
151 0.41
152 0.42
153 0.44
154 0.42
155 0.41
156 0.46
157 0.44
158 0.47
159 0.48
160 0.44
161 0.39
162 0.38
163 0.37
164 0.36
165 0.41
166 0.38
167 0.34
168 0.39
169 0.4
170 0.43
171 0.41
172 0.36
173 0.32
174 0.28
175 0.29
176 0.24
177 0.22
178 0.18
179 0.2
180 0.16