Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R097

Protein Details
Accession C4R097   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSRRFYRKFDRKLKLRRSWAHTEIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, mito_nucl 12.833, nucl 8.5, cyto_nucl 6.666
Family & Domain DBs
KEGG ppa:PAS_chr2-1_0306  -  
Amino Acid Sequences MSRRFYRKFDRKLKLRRSWAHTEISQWNGKTHLGPALIGGRSSRKQVDPDLFEKLNVILENRKQKRSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.87
4 0.84
5 0.82
6 0.76
7 0.7
8 0.6
9 0.55
10 0.49
11 0.45
12 0.41
13 0.33
14 0.29
15 0.25
16 0.25
17 0.2
18 0.16
19 0.15
20 0.12
21 0.11
22 0.11
23 0.13
24 0.12
25 0.12
26 0.12
27 0.13
28 0.14
29 0.17
30 0.18
31 0.18
32 0.2
33 0.26
34 0.32
35 0.34
36 0.35
37 0.39
38 0.37
39 0.35
40 0.33
41 0.27
42 0.23
43 0.19
44 0.19
45 0.19
46 0.26
47 0.37
48 0.43