Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JMA0

Protein Details
Accession A0A421JMA0    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
178-205RVKNWRDYSHKVDKKNKKKKSNKPKVLVBasic
NLS Segment(s)
PositionSequence
188-202KVDKKNKKKKSNKPK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MNNEDLERILSLEESALNRTTEIERVLKCNQFDYFDILQLNPLNHDDANFASIIKRVYRKKSLLIHPDKTDHPRASDAFDRLKKAEKILSCNNDQEEEFKEKKRLIAIYKSVISGNDINDVAKQVGEILQDEINQQELQVLYQQTAKQWKHEQEQKLKRERELKKQLENKWEDERDVRVKNWRDYSHKVDKKNKKKKSNKPKVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.14
4 0.14
5 0.14
6 0.16
7 0.17
8 0.17
9 0.2
10 0.23
11 0.23
12 0.28
13 0.33
14 0.36
15 0.35
16 0.36
17 0.34
18 0.31
19 0.31
20 0.33
21 0.29
22 0.27
23 0.27
24 0.23
25 0.24
26 0.23
27 0.22
28 0.16
29 0.16
30 0.15
31 0.14
32 0.14
33 0.13
34 0.12
35 0.12
36 0.11
37 0.1
38 0.09
39 0.11
40 0.12
41 0.14
42 0.21
43 0.26
44 0.33
45 0.41
46 0.43
47 0.49
48 0.56
49 0.61
50 0.65
51 0.67
52 0.65
53 0.6
54 0.61
55 0.57
56 0.54
57 0.52
58 0.43
59 0.36
60 0.34
61 0.32
62 0.33
63 0.33
64 0.31
65 0.31
66 0.32
67 0.33
68 0.3
69 0.36
70 0.32
71 0.3
72 0.31
73 0.26
74 0.3
75 0.35
76 0.38
77 0.34
78 0.35
79 0.34
80 0.3
81 0.28
82 0.23
83 0.19
84 0.22
85 0.22
86 0.21
87 0.24
88 0.23
89 0.24
90 0.25
91 0.25
92 0.23
93 0.27
94 0.28
95 0.29
96 0.29
97 0.29
98 0.26
99 0.22
100 0.21
101 0.16
102 0.13
103 0.12
104 0.11
105 0.11
106 0.11
107 0.12
108 0.09
109 0.08
110 0.07
111 0.05
112 0.06
113 0.06
114 0.07
115 0.08
116 0.08
117 0.09
118 0.09
119 0.09
120 0.09
121 0.09
122 0.08
123 0.08
124 0.07
125 0.07
126 0.11
127 0.11
128 0.1
129 0.13
130 0.14
131 0.16
132 0.25
133 0.25
134 0.28
135 0.35
136 0.41
137 0.47
138 0.55
139 0.6
140 0.62
141 0.71
142 0.74
143 0.77
144 0.74
145 0.71
146 0.73
147 0.71
148 0.71
149 0.73
150 0.71
151 0.71
152 0.76
153 0.77
154 0.77
155 0.75
156 0.69
157 0.67
158 0.62
159 0.55
160 0.49
161 0.49
162 0.47
163 0.46
164 0.43
165 0.44
166 0.48
167 0.54
168 0.59
169 0.59
170 0.59
171 0.63
172 0.69
173 0.7
174 0.7
175 0.72
176 0.74
177 0.79
178 0.83
179 0.86
180 0.88
181 0.88
182 0.92
183 0.94
184 0.95
185 0.95