Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JHQ9

Protein Details
Accession A0A421JHQ9    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MRSLPPPRITRARRWKRIKRAIKNLFIQGHydrophilic
NLS Segment(s)
PositionSequence
8-21RITRARRWKRIKRA
Subcellular Location(s) mito 18.5, mito_nucl 13.833, nucl 8, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MRSLPPPRITRARRWKRIKRAIKNLFIQGYISDFSVFHRAPSNFTISKIHKSKFSSRLKKQSEIGIVQTANIGLQFAGYLETWLYMKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.88
4 0.93
5 0.93
6 0.93
7 0.93
8 0.91
9 0.88
10 0.83
11 0.77
12 0.68
13 0.57
14 0.46
15 0.35
16 0.28
17 0.2
18 0.16
19 0.1
20 0.09
21 0.1
22 0.15
23 0.14
24 0.13
25 0.18
26 0.18
27 0.2
28 0.22
29 0.26
30 0.21
31 0.22
32 0.27
33 0.24
34 0.31
35 0.34
36 0.33
37 0.33
38 0.37
39 0.44
40 0.49
41 0.57
42 0.6
43 0.64
44 0.74
45 0.74
46 0.74
47 0.68
48 0.64
49 0.59
50 0.51
51 0.45
52 0.38
53 0.33
54 0.28
55 0.26
56 0.19
57 0.13
58 0.11
59 0.09
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.06
67 0.06
68 0.07