Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JUD5

Protein Details
Accession A0A421JUD5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
34-59EKKDYVRRCSLKKNKTKPQPCSFCLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MSILGGKKKESSRRSSVASNSSSSGKETFANFDEKKDYVRRCSLKKNKTKPQPCSFCLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.57
4 0.54
5 0.49
6 0.43
7 0.37
8 0.34
9 0.3
10 0.26
11 0.22
12 0.16
13 0.15
14 0.14
15 0.15
16 0.14
17 0.21
18 0.19
19 0.2
20 0.21
21 0.2
22 0.23
23 0.27
24 0.29
25 0.28
26 0.37
27 0.42
28 0.45
29 0.56
30 0.63
31 0.67
32 0.75
33 0.8
34 0.81
35 0.86
36 0.9
37 0.89
38 0.9
39 0.88
40 0.8