Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JUD6

Protein Details
Accession A0A421JUD6   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-31KIKLKAKSPARVTKKQQNPKRSAPKIIHydrophilic
NLS Segment(s)
PositionSequence
5-44KIKLKAKSPARVTKKQQNPKRSAPKIIKPKKVVAKEAKKL
78-90EKEQKAADKKKSK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGKIKLKAKSPARVTKKQQNPKRSAPKIIKPKKVVAKEAKKLSKVHQSQLMTSTEKLIASRVGHLELIKGSRRQIEKEQKAADKKKSKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.75
3 0.78
4 0.79
5 0.82
6 0.83
7 0.83
8 0.83
9 0.82
10 0.83
11 0.86
12 0.8
13 0.79
14 0.77
15 0.77
16 0.78
17 0.8
18 0.78
19 0.71
20 0.74
21 0.73
22 0.69
23 0.68
24 0.67
25 0.67
26 0.66
27 0.71
28 0.67
29 0.62
30 0.59
31 0.55
32 0.54
33 0.47
34 0.43
35 0.41
36 0.37
37 0.35
38 0.36
39 0.35
40 0.26
41 0.24
42 0.22
43 0.16
44 0.16
45 0.15
46 0.12
47 0.12
48 0.12
49 0.14
50 0.13
51 0.14
52 0.15
53 0.14
54 0.15
55 0.14
56 0.17
57 0.18
58 0.19
59 0.2
60 0.26
61 0.29
62 0.33
63 0.42
64 0.5
65 0.53
66 0.6
67 0.65
68 0.67
69 0.74
70 0.77
71 0.77