Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421JPU3

Protein Details
Accession A0A421JPU3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAAAAEKRKATRKKKDPDAPKRSLSHydrophilic
NLS Segment(s)
PositionSequence
7-21KRKATRKKKDPDAPK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAAAAEKRKATRKKKDPDAPKRSLSAYMFFANENRDIVRAENPGISFGQVGKLLGEKWKALSDDEKVPYNNKAETDKKRYEKEKAEYAKKNSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.88
3 0.9
4 0.91
5 0.9
6 0.86
7 0.79
8 0.71
9 0.62
10 0.58
11 0.48
12 0.4
13 0.34
14 0.29
15 0.26
16 0.23
17 0.22
18 0.19
19 0.18
20 0.15
21 0.12
22 0.11
23 0.11
24 0.12
25 0.14
26 0.13
27 0.13
28 0.14
29 0.13
30 0.14
31 0.13
32 0.12
33 0.09
34 0.08
35 0.09
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.09
42 0.11
43 0.09
44 0.11
45 0.13
46 0.14
47 0.14
48 0.17
49 0.18
50 0.23
51 0.25
52 0.27
53 0.26
54 0.27
55 0.29
56 0.3
57 0.28
58 0.24
59 0.29
60 0.34
61 0.42
62 0.49
63 0.55
64 0.59
65 0.66
66 0.7
67 0.72
68 0.73
69 0.71
70 0.73
71 0.73
72 0.76
73 0.76