Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421JM03

Protein Details
Accession A0A421JM03    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSLRSKSKLRAKSVKRKGEFSKHydrophilic
82-105RDSRNQIYKQRQIKANKKGKSLKFHydrophilic
NLS Segment(s)
PositionSequence
6-20RSKSKLRAKSVKRKG
96-101ANKKGK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKSKLRAKSVKRKGEFSKFVDSRNTRIARKLADETVKQDEAKAAKEGEEVEESTETTMEVDESKTEKKKVSTSGWRDSRNQIYKQRQIKANKKGKSLKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.87
3 0.87
4 0.81
5 0.8
6 0.79
7 0.79
8 0.76
9 0.69
10 0.7
11 0.61
12 0.59
13 0.61
14 0.54
15 0.48
16 0.5
17 0.5
18 0.4
19 0.43
20 0.44
21 0.37
22 0.38
23 0.38
24 0.33
25 0.33
26 0.33
27 0.32
28 0.34
29 0.33
30 0.28
31 0.25
32 0.23
33 0.2
34 0.2
35 0.18
36 0.13
37 0.11
38 0.12
39 0.12
40 0.11
41 0.11
42 0.09
43 0.09
44 0.09
45 0.08
46 0.08
47 0.08
48 0.06
49 0.05
50 0.05
51 0.04
52 0.04
53 0.05
54 0.06
55 0.08
56 0.13
57 0.17
58 0.19
59 0.22
60 0.24
61 0.29
62 0.34
63 0.41
64 0.47
65 0.51
66 0.59
67 0.64
68 0.65
69 0.64
70 0.65
71 0.66
72 0.63
73 0.63
74 0.63
75 0.65
76 0.7
77 0.75
78 0.76
79 0.74
80 0.77
81 0.79
82 0.8
83 0.8
84 0.77
85 0.79