Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421JSD5

Protein Details
Accession A0A421JSD5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-92FQDWRIQRTKKLKFRYKPKTSVVMIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, E.R. 8, mito 3, extr 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006976  VanZ-like  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04892  VanZ  
Amino Acid Sequences MEFYLVFNTKHKSSTVLRMITFLICTCGASVSSEIIQHVVNPTRVFDIFDILFNIGGSLCGLTICCVFQDWRIQRTKKLKFRYKPKTSVVMIPTISHHTSKVEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.41
4 0.39
5 0.39
6 0.4
7 0.35
8 0.31
9 0.21
10 0.16
11 0.11
12 0.11
13 0.1
14 0.1
15 0.09
16 0.1
17 0.1
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.09
24 0.08
25 0.11
26 0.12
27 0.13
28 0.13
29 0.14
30 0.15
31 0.15
32 0.16
33 0.13
34 0.13
35 0.11
36 0.11
37 0.11
38 0.09
39 0.09
40 0.08
41 0.07
42 0.05
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.06
55 0.08
56 0.18
57 0.21
58 0.27
59 0.35
60 0.37
61 0.45
62 0.55
63 0.63
64 0.63
65 0.7
66 0.74
67 0.76
68 0.85
69 0.88
70 0.87
71 0.85
72 0.82
73 0.8
74 0.73
75 0.71
76 0.62
77 0.57
78 0.48
79 0.41
80 0.37
81 0.34
82 0.33
83 0.27
84 0.25
85 0.24