Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7Y1N6

Protein Details
Accession G7Y1N6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKKGNKHRKKNLVRVAKPVAEHydrophilic
NLS Segment(s)
PositionSequence
4-11KGNKHRKK
Subcellular Location(s) cyto 17.5, cyto_mito 14, mito 9.5
Family & Domain DBs
Amino Acid Sequences MAKKGNKHRKKNLVRVAKPVAEVVCETLECPAAENWETTPPCDETGDAEPIAETVYDAVACPAAENWETTPPCDETGGAEPVSETVGKHAVTAGYDSYNVSTPGIHEYDQPETR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.8
4 0.72
5 0.62
6 0.54
7 0.44
8 0.34
9 0.3
10 0.23
11 0.17
12 0.14
13 0.13
14 0.11
15 0.12
16 0.1
17 0.11
18 0.09
19 0.11
20 0.12
21 0.12
22 0.13
23 0.18
24 0.19
25 0.18
26 0.2
27 0.18
28 0.18
29 0.18
30 0.17
31 0.13
32 0.16
33 0.17
34 0.14
35 0.13
36 0.12
37 0.11
38 0.11
39 0.08
40 0.05
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.05
51 0.05
52 0.06
53 0.07
54 0.14
55 0.15
56 0.15
57 0.18
58 0.17
59 0.18
60 0.18
61 0.17
62 0.12
63 0.16
64 0.17
65 0.14
66 0.13
67 0.12
68 0.12
69 0.13
70 0.11
71 0.07
72 0.07
73 0.1
74 0.1
75 0.1
76 0.11
77 0.11
78 0.11
79 0.12
80 0.12
81 0.1
82 0.1
83 0.11
84 0.11
85 0.12
86 0.13
87 0.11
88 0.1
89 0.1
90 0.15
91 0.17
92 0.16
93 0.17
94 0.21