Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JMJ9

Protein Details
Accession A0A421JMJ9   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
173-193KVEQIDDKKKKKKDAAAAAAAHydrophilic
NLS Segment(s)
PositionSequence
180-185KKKKKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046447  DENR_C  
IPR005873  DENR_eukaryotes  
IPR001950  SUI1  
IPR036877  SUI1_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01253  SUI1  
PROSITE View protein in PROSITE  
PS50296  SUI1  
CDD cd11607  DENR_C  
Amino Acid Sequences MTELAPKSITYCGVCSWPPEYCEFGVTRTKCQAWLEANDAELYQKLYTSDLIQQTSTLSLEKQEKLNSDLAKAQHKQELKQERELQKMLNSKIIIKRIERNKRKHIISISGLEVFNLDSKKLAKTFASKFATGASVSKMADKTEEILIQGDVSDEAKEYIEKLLQDQGLNDIKVEQIDDKKKKKKDAAAAAAAGATNSGNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.24
5 0.24
6 0.25
7 0.27
8 0.24
9 0.26
10 0.24
11 0.24
12 0.3
13 0.3
14 0.32
15 0.34
16 0.34
17 0.35
18 0.35
19 0.38
20 0.34
21 0.36
22 0.36
23 0.31
24 0.3
25 0.27
26 0.26
27 0.2
28 0.16
29 0.13
30 0.09
31 0.08
32 0.08
33 0.09
34 0.1
35 0.11
36 0.17
37 0.18
38 0.19
39 0.19
40 0.19
41 0.18
42 0.18
43 0.17
44 0.11
45 0.08
46 0.11
47 0.16
48 0.18
49 0.2
50 0.21
51 0.23
52 0.25
53 0.3
54 0.26
55 0.24
56 0.26
57 0.25
58 0.3
59 0.3
60 0.29
61 0.29
62 0.3
63 0.3
64 0.35
65 0.43
66 0.39
67 0.46
68 0.52
69 0.52
70 0.55
71 0.53
72 0.46
73 0.41
74 0.44
75 0.36
76 0.32
77 0.28
78 0.27
79 0.3
80 0.33
81 0.3
82 0.27
83 0.33
84 0.39
85 0.49
86 0.54
87 0.58
88 0.63
89 0.68
90 0.68
91 0.65
92 0.59
93 0.54
94 0.48
95 0.43
96 0.35
97 0.29
98 0.27
99 0.22
100 0.19
101 0.13
102 0.13
103 0.1
104 0.09
105 0.08
106 0.09
107 0.11
108 0.12
109 0.13
110 0.12
111 0.19
112 0.22
113 0.3
114 0.33
115 0.31
116 0.31
117 0.3
118 0.3
119 0.23
120 0.21
121 0.14
122 0.12
123 0.12
124 0.15
125 0.14
126 0.13
127 0.14
128 0.13
129 0.14
130 0.14
131 0.14
132 0.12
133 0.12
134 0.12
135 0.11
136 0.1
137 0.08
138 0.06
139 0.07
140 0.06
141 0.06
142 0.06
143 0.07
144 0.07
145 0.07
146 0.09
147 0.1
148 0.1
149 0.12
150 0.17
151 0.18
152 0.18
153 0.18
154 0.22
155 0.24
156 0.24
157 0.23
158 0.18
159 0.17
160 0.17
161 0.18
162 0.16
163 0.2
164 0.31
165 0.4
166 0.5
167 0.58
168 0.65
169 0.74
170 0.78
171 0.79
172 0.8
173 0.81
174 0.8
175 0.77
176 0.71
177 0.61
178 0.53
179 0.43
180 0.32
181 0.22