Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JI02

Protein Details
Accession A0A421JI02   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
94-119REPKYEVVKTKPRQRREKTFQVENFQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MLRMYSTSPLTQLKVNSNGNQHLYAIFKLHNMPYLVTKGDLIYLNYKLQGVEIGDELRLNDVTTLGSPSYTYNEPDGIDTSLYSLKANVVEITREPKYEVVKTKPRQRREKTFQVENFQTVLRISELAVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.4
3 0.4
4 0.43
5 0.45
6 0.45
7 0.42
8 0.36
9 0.3
10 0.27
11 0.23
12 0.2
13 0.16
14 0.14
15 0.16
16 0.16
17 0.19
18 0.18
19 0.18
20 0.19
21 0.2
22 0.2
23 0.17
24 0.17
25 0.13
26 0.14
27 0.14
28 0.13
29 0.14
30 0.15
31 0.15
32 0.15
33 0.15
34 0.13
35 0.11
36 0.11
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.05
53 0.05
54 0.05
55 0.06
56 0.09
57 0.09
58 0.1
59 0.1
60 0.11
61 0.11
62 0.12
63 0.13
64 0.1
65 0.1
66 0.08
67 0.09
68 0.09
69 0.09
70 0.09
71 0.07
72 0.08
73 0.08
74 0.09
75 0.09
76 0.08
77 0.09
78 0.11
79 0.16
80 0.16
81 0.16
82 0.17
83 0.19
84 0.22
85 0.27
86 0.33
87 0.36
88 0.45
89 0.53
90 0.62
91 0.68
92 0.74
93 0.79
94 0.82
95 0.84
96 0.83
97 0.86
98 0.84
99 0.85
100 0.82
101 0.8
102 0.74
103 0.65
104 0.57
105 0.46
106 0.39
107 0.29
108 0.24
109 0.17
110 0.13