Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JUT9

Protein Details
Accession A0A421JUT9   
Localization Confidence High
Confidence Score 18.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-45FTNASLPPKPKTNKKSKEKSDDETRTLHydrophilic
54-79GPSAGNTKSKNNKQLKKQIERKLATSHydrophilic
195-214EKPAVTKKTNSKKDKKIEDTHydrophilic
NLS Segment(s)
PositionSequence
99-103SRKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MAHELPIQLQPSSGKNNTFTNASLPPKPKTNKKSKEKSDDETRTLPSGEKVDFGPSAGNTKSKNNKQLKKQIERKLATSLSLPNGEKPDFMNEKSNKESRKKKSGPINEPSLPNGEKPNFQPGSSLRSKKKNDVPEQSLPNGEKPNFQPSKPSSKKSTLPSGDKSTLQHQKSNSKSNIINEQSLPSGEKPNFYNEKPAVTKKTNSKKDKKIEDTYAGSSFHSSPLALNLPKPSFRASPRQANAGGAEDELSSSSNSSVVSSTSPVLAQGVAPGPGDPPPMNPAPLTHPVTAYPPGSIPPPHIYQHPTPQPQHPYYPQFLQPGFSYQVTPQGYIQYQYPPYGQHHPQPQPSQPGVIYPHYQTPPPQMAPLVTQQQPQQQQQQQPAGGHKITFNELLSSSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.38
4 0.39
5 0.38
6 0.35
7 0.32
8 0.35
9 0.37
10 0.41
11 0.42
12 0.44
13 0.51
14 0.58
15 0.63
16 0.67
17 0.73
18 0.75
19 0.82
20 0.88
21 0.89
22 0.92
23 0.89
24 0.87
25 0.87
26 0.85
27 0.8
28 0.73
29 0.65
30 0.57
31 0.5
32 0.43
33 0.35
34 0.31
35 0.26
36 0.23
37 0.2
38 0.21
39 0.2
40 0.2
41 0.19
42 0.15
43 0.19
44 0.19
45 0.22
46 0.21
47 0.3
48 0.4
49 0.45
50 0.55
51 0.61
52 0.68
53 0.75
54 0.83
55 0.84
56 0.85
57 0.87
58 0.87
59 0.87
60 0.81
61 0.73
62 0.71
63 0.61
64 0.51
65 0.44
66 0.38
67 0.32
68 0.34
69 0.32
70 0.28
71 0.31
72 0.3
73 0.28
74 0.25
75 0.3
76 0.28
77 0.3
78 0.36
79 0.35
80 0.4
81 0.45
82 0.5
83 0.49
84 0.55
85 0.63
86 0.62
87 0.7
88 0.7
89 0.72
90 0.76
91 0.79
92 0.79
93 0.76
94 0.75
95 0.68
96 0.64
97 0.58
98 0.52
99 0.42
100 0.35
101 0.34
102 0.28
103 0.27
104 0.27
105 0.36
106 0.32
107 0.31
108 0.33
109 0.28
110 0.34
111 0.39
112 0.44
113 0.41
114 0.49
115 0.53
116 0.58
117 0.64
118 0.66
119 0.68
120 0.69
121 0.7
122 0.68
123 0.69
124 0.62
125 0.57
126 0.48
127 0.43
128 0.39
129 0.32
130 0.29
131 0.27
132 0.36
133 0.34
134 0.33
135 0.37
136 0.37
137 0.48
138 0.49
139 0.51
140 0.47
141 0.51
142 0.57
143 0.54
144 0.59
145 0.55
146 0.55
147 0.55
148 0.55
149 0.51
150 0.47
151 0.44
152 0.42
153 0.44
154 0.4
155 0.39
156 0.36
157 0.42
158 0.46
159 0.53
160 0.46
161 0.43
162 0.43
163 0.42
164 0.47
165 0.4
166 0.37
167 0.29
168 0.28
169 0.24
170 0.22
171 0.21
172 0.13
173 0.16
174 0.15
175 0.16
176 0.16
177 0.22
178 0.26
179 0.25
180 0.31
181 0.26
182 0.3
183 0.31
184 0.34
185 0.33
186 0.32
187 0.37
188 0.39
189 0.49
190 0.54
191 0.61
192 0.66
193 0.7
194 0.76
195 0.8
196 0.79
197 0.74
198 0.69
199 0.64
200 0.58
201 0.51
202 0.44
203 0.35
204 0.28
205 0.23
206 0.19
207 0.15
208 0.12
209 0.09
210 0.07
211 0.09
212 0.13
213 0.12
214 0.13
215 0.16
216 0.17
217 0.18
218 0.19
219 0.2
220 0.21
221 0.24
222 0.33
223 0.34
224 0.42
225 0.43
226 0.46
227 0.43
228 0.4
229 0.37
230 0.3
231 0.24
232 0.15
233 0.14
234 0.09
235 0.09
236 0.08
237 0.08
238 0.05
239 0.05
240 0.06
241 0.06
242 0.06
243 0.06
244 0.07
245 0.07
246 0.07
247 0.08
248 0.09
249 0.08
250 0.08
251 0.08
252 0.08
253 0.07
254 0.06
255 0.07
256 0.07
257 0.07
258 0.07
259 0.07
260 0.08
261 0.08
262 0.11
263 0.1
264 0.1
265 0.14
266 0.15
267 0.16
268 0.15
269 0.16
270 0.19
271 0.26
272 0.29
273 0.26
274 0.25
275 0.25
276 0.28
277 0.3
278 0.25
279 0.18
280 0.14
281 0.15
282 0.16
283 0.16
284 0.17
285 0.19
286 0.22
287 0.23
288 0.25
289 0.3
290 0.32
291 0.41
292 0.46
293 0.49
294 0.48
295 0.54
296 0.59
297 0.57
298 0.6
299 0.57
300 0.54
301 0.51
302 0.53
303 0.5
304 0.47
305 0.44
306 0.39
307 0.33
308 0.31
309 0.3
310 0.27
311 0.24
312 0.19
313 0.27
314 0.26
315 0.26
316 0.22
317 0.24
318 0.24
319 0.24
320 0.25
321 0.23
322 0.24
323 0.25
324 0.25
325 0.23
326 0.27
327 0.34
328 0.36
329 0.37
330 0.45
331 0.51
332 0.58
333 0.61
334 0.62
335 0.63
336 0.6
337 0.57
338 0.47
339 0.45
340 0.41
341 0.39
342 0.36
343 0.3
344 0.36
345 0.34
346 0.36
347 0.34
348 0.37
349 0.4
350 0.39
351 0.38
352 0.32
353 0.31
354 0.33
355 0.37
356 0.36
357 0.31
358 0.33
359 0.35
360 0.42
361 0.47
362 0.5
363 0.53
364 0.54
365 0.59
366 0.64
367 0.68
368 0.63
369 0.6
370 0.6
371 0.57
372 0.51
373 0.45
374 0.39
375 0.34
376 0.34
377 0.33
378 0.28
379 0.23
380 0.23