Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421JI60

Protein Details
Accession A0A421JI60    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
309-335IERRENERIRNLRRLKRENRKGDYDDYBasic
NLS Segment(s)
PositionSequence
320-326LRRLKRE
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006939  SNF5  
Gene Ontology GO:0000228  C:nuclear chromosome  
GO:0070603  C:SWI/SNF superfamily-type complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04855  SNF5  
Amino Acid Sequences MSSLSFDTTSFYVQGLASGLSKRLLDENDNSLLLNIAPTGRQAKRIAQQINYSEDFIDDFDFEDTPSANLSNKGSMTNQAQVNVQKLSPARNTPYMKELEDEQKITELVNKSQILIPIKIALENSNSTHKLVDFFMWNLNESLITPYQFAEIVCNDLELPNAMISQIAESINQQIDEYNFASNLQLTTSNPCNVIIDLAVNLNKQLYQDRFEWDLNQTEITPEQFAQIVVADVGLSLEFKPAISHALHEIIIRVKKEIIEGTFNNEIHNLHLVRGIIFENGIRIFTETSVQNGNDHWEPLVEVLTSSEIERRENERIRNLRRLKRENRKGDYDDYSGTKRRQVGRRRFDELEGSWKSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.12
4 0.12
5 0.13
6 0.14
7 0.14
8 0.14
9 0.15
10 0.18
11 0.2
12 0.23
13 0.26
14 0.29
15 0.31
16 0.31
17 0.29
18 0.25
19 0.22
20 0.18
21 0.14
22 0.09
23 0.07
24 0.07
25 0.1
26 0.17
27 0.18
28 0.24
29 0.27
30 0.33
31 0.39
32 0.48
33 0.5
34 0.47
35 0.53
36 0.52
37 0.55
38 0.49
39 0.43
40 0.35
41 0.3
42 0.26
43 0.19
44 0.16
45 0.1
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.08
53 0.09
54 0.09
55 0.09
56 0.11
57 0.13
58 0.15
59 0.15
60 0.17
61 0.17
62 0.21
63 0.23
64 0.27
65 0.27
66 0.25
67 0.27
68 0.28
69 0.3
70 0.26
71 0.23
72 0.2
73 0.2
74 0.24
75 0.26
76 0.28
77 0.3
78 0.37
79 0.4
80 0.38
81 0.42
82 0.4
83 0.36
84 0.33
85 0.32
86 0.31
87 0.31
88 0.3
89 0.25
90 0.23
91 0.22
92 0.21
93 0.22
94 0.18
95 0.16
96 0.22
97 0.22
98 0.22
99 0.24
100 0.27
101 0.25
102 0.23
103 0.22
104 0.19
105 0.19
106 0.18
107 0.17
108 0.14
109 0.13
110 0.14
111 0.16
112 0.18
113 0.19
114 0.19
115 0.19
116 0.18
117 0.17
118 0.16
119 0.16
120 0.12
121 0.12
122 0.16
123 0.15
124 0.16
125 0.14
126 0.13
127 0.12
128 0.1
129 0.12
130 0.1
131 0.1
132 0.09
133 0.09
134 0.1
135 0.1
136 0.1
137 0.09
138 0.08
139 0.09
140 0.09
141 0.09
142 0.08
143 0.08
144 0.08
145 0.06
146 0.06
147 0.05
148 0.05
149 0.04
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.05
156 0.06
157 0.08
158 0.08
159 0.08
160 0.08
161 0.07
162 0.07
163 0.09
164 0.1
165 0.08
166 0.07
167 0.08
168 0.08
169 0.07
170 0.07
171 0.05
172 0.06
173 0.06
174 0.1
175 0.12
176 0.13
177 0.13
178 0.13
179 0.13
180 0.12
181 0.12
182 0.08
183 0.06
184 0.06
185 0.06
186 0.07
187 0.06
188 0.06
189 0.06
190 0.06
191 0.07
192 0.11
193 0.12
194 0.14
195 0.16
196 0.19
197 0.22
198 0.22
199 0.23
200 0.21
201 0.22
202 0.19
203 0.18
204 0.15
205 0.12
206 0.13
207 0.12
208 0.11
209 0.08
210 0.08
211 0.08
212 0.08
213 0.07
214 0.07
215 0.06
216 0.05
217 0.05
218 0.04
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.04
225 0.04
226 0.04
227 0.05
228 0.05
229 0.08
230 0.08
231 0.09
232 0.1
233 0.12
234 0.13
235 0.12
236 0.14
237 0.16
238 0.19
239 0.18
240 0.18
241 0.17
242 0.17
243 0.19
244 0.2
245 0.17
246 0.2
247 0.2
248 0.25
249 0.29
250 0.29
251 0.27
252 0.25
253 0.23
254 0.19
255 0.24
256 0.18
257 0.14
258 0.16
259 0.16
260 0.15
261 0.16
262 0.15
263 0.1
264 0.1
265 0.1
266 0.1
267 0.1
268 0.1
269 0.09
270 0.1
271 0.1
272 0.1
273 0.14
274 0.12
275 0.14
276 0.17
277 0.17
278 0.17
279 0.17
280 0.21
281 0.18
282 0.19
283 0.17
284 0.13
285 0.13
286 0.13
287 0.14
288 0.09
289 0.08
290 0.08
291 0.09
292 0.09
293 0.09
294 0.12
295 0.12
296 0.14
297 0.18
298 0.22
299 0.31
300 0.37
301 0.42
302 0.49
303 0.58
304 0.64
305 0.7
306 0.75
307 0.75
308 0.79
309 0.83
310 0.84
311 0.86
312 0.89
313 0.89
314 0.87
315 0.87
316 0.82
317 0.78
318 0.73
319 0.66
320 0.59
321 0.53
322 0.51
323 0.49
324 0.46
325 0.45
326 0.46
327 0.52
328 0.57
329 0.63
330 0.68
331 0.72
332 0.78
333 0.8
334 0.76
335 0.7
336 0.68
337 0.6
338 0.59