Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409Y657

Protein Details
Accession A0A409Y657    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
80-122PLDLRPKKTRAIRRRLTKHESSLKTLKQTKKDKNFPIRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
84-113RPKKTRAIRRRLTKHESSLKTLKQTKKDKN
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPKVKAYELQSKSKNDLSKQLTELKTELLTLRVQKIAGSSASKLTKISSVRKSIARVLTVMNQKQRQNLREYYKDKKYLPLDLRPKKTRAIRRRLTKHESSLKTLKQTKKDKNFPIRKYAVKAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.5
3 0.54
4 0.5
5 0.49
6 0.49
7 0.53
8 0.48
9 0.45
10 0.42
11 0.35
12 0.29
13 0.25
14 0.22
15 0.15
16 0.16
17 0.16
18 0.18
19 0.17
20 0.17
21 0.16
22 0.16
23 0.16
24 0.16
25 0.15
26 0.13
27 0.18
28 0.19
29 0.19
30 0.18
31 0.17
32 0.2
33 0.22
34 0.29
35 0.29
36 0.33
37 0.35
38 0.38
39 0.39
40 0.4
41 0.38
42 0.31
43 0.26
44 0.23
45 0.26
46 0.29
47 0.29
48 0.3
49 0.32
50 0.32
51 0.37
52 0.41
53 0.38
54 0.38
55 0.42
56 0.43
57 0.47
58 0.52
59 0.53
60 0.55
61 0.58
62 0.53
63 0.54
64 0.5
65 0.5
66 0.5
67 0.52
68 0.55
69 0.58
70 0.67
71 0.64
72 0.63
73 0.62
74 0.66
75 0.67
76 0.67
77 0.69
78 0.7
79 0.76
80 0.83
81 0.85
82 0.84
83 0.8
84 0.79
85 0.79
86 0.73
87 0.69
88 0.68
89 0.63
90 0.64
91 0.66
92 0.64
93 0.64
94 0.7
95 0.73
96 0.76
97 0.82
98 0.84
99 0.86
100 0.89
101 0.85
102 0.85
103 0.81
104 0.77