Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7X969

Protein Details
Accession G7X969   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
77-99APNTPTPKKIRKTNEKTSKVKAEHydrophilic
NLS Segment(s)
PositionSequence
66-68KRA
81-92PTPKKIRKTNEK
Subcellular Location(s) cyto_nucl 11.5, nucl 11, cyto 10, mito 4
Family & Domain DBs
Amino Acid Sequences MTRWTDENKATLLRLIFETQNFQIDLDKIVDAWPGDDKPTGKALSEQLGKYRKPGSSITFRFTKAKRAAPGGSGSSAPNTPTPKKIRKTNEKTSKVKAEVPSSPAPVPKIKGESVEDDKKFPEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.21
4 0.2
5 0.24
6 0.21
7 0.23
8 0.22
9 0.19
10 0.19
11 0.17
12 0.18
13 0.15
14 0.14
15 0.11
16 0.11
17 0.12
18 0.1
19 0.1
20 0.11
21 0.1
22 0.11
23 0.13
24 0.14
25 0.14
26 0.18
27 0.18
28 0.16
29 0.18
30 0.18
31 0.22
32 0.25
33 0.23
34 0.26
35 0.3
36 0.3
37 0.31
38 0.33
39 0.27
40 0.27
41 0.29
42 0.28
43 0.33
44 0.35
45 0.35
46 0.34
47 0.35
48 0.38
49 0.35
50 0.39
51 0.34
52 0.37
53 0.35
54 0.37
55 0.36
56 0.32
57 0.34
58 0.27
59 0.23
60 0.19
61 0.17
62 0.14
63 0.13
64 0.13
65 0.14
66 0.17
67 0.18
68 0.25
69 0.33
70 0.4
71 0.47
72 0.55
73 0.62
74 0.69
75 0.76
76 0.8
77 0.83
78 0.83
79 0.82
80 0.8
81 0.79
82 0.71
83 0.68
84 0.62
85 0.57
86 0.51
87 0.52
88 0.48
89 0.43
90 0.41
91 0.37
92 0.36
93 0.34
94 0.33
95 0.32
96 0.33
97 0.31
98 0.33
99 0.34
100 0.39
101 0.43
102 0.49
103 0.46
104 0.43