Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409YYK5

Protein Details
Accession A0A409YYK5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-88LGSTIIKEKRRKAQQARLRTAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, extr 6, mito 3, E.R. 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MGSADKALGSVMLLAASFVFTYYTTWSLLLPFLDKSNPLHDWFPAREWAVRLPAFILVVGLTAIGSFLGSTIIKEKRRKAQQARLRTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.08
10 0.1
11 0.1
12 0.1
13 0.1
14 0.1
15 0.11
16 0.1
17 0.09
18 0.09
19 0.09
20 0.09
21 0.1
22 0.11
23 0.14
24 0.16
25 0.17
26 0.17
27 0.17
28 0.2
29 0.2
30 0.2
31 0.18
32 0.17
33 0.16
34 0.17
35 0.18
36 0.19
37 0.18
38 0.17
39 0.15
40 0.14
41 0.13
42 0.12
43 0.1
44 0.05
45 0.05
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.04
56 0.05
57 0.06
58 0.12
59 0.19
60 0.26
61 0.33
62 0.41
63 0.49
64 0.6
65 0.7
66 0.75
67 0.79
68 0.81