Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409YJV8

Protein Details
Accession A0A409YJV8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-35TSSSGGKAAKKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
12-29GGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences AKAKAAPTSSSGGKAAKKKKWSKGKVKDKAQHAVVLDKATYDRILKEVPTFKFISQSILIERLKINGSLARVAIRHLEKEKLIKRIVHHSAQLIYTRATSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.48
4 0.56
5 0.63
6 0.71
7 0.78
8 0.82
9 0.84
10 0.86
11 0.9
12 0.9
13 0.91
14 0.88
15 0.84
16 0.81
17 0.71
18 0.63
19 0.53
20 0.46
21 0.37
22 0.3
23 0.23
24 0.16
25 0.15
26 0.12
27 0.12
28 0.1
29 0.08
30 0.09
31 0.1
32 0.1
33 0.14
34 0.19
35 0.19
36 0.22
37 0.23
38 0.21
39 0.24
40 0.23
41 0.23
42 0.17
43 0.18
44 0.15
45 0.19
46 0.19
47 0.17
48 0.17
49 0.15
50 0.15
51 0.14
52 0.14
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.12
59 0.13
60 0.18
61 0.17
62 0.2
63 0.21
64 0.24
65 0.25
66 0.34
67 0.39
68 0.4
69 0.42
70 0.42
71 0.43
72 0.5
73 0.54
74 0.49
75 0.46
76 0.43
77 0.42
78 0.41
79 0.4
80 0.32
81 0.27
82 0.23