Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G7XEP9

Protein Details
Accession G7XEP9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
160-181LPDQQRRKAIRDHNRKKAIKYKBasic
NLS Segment(s)
PositionSequence
166-177RKAIRDHNRKKA
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021475  DUF3128  
Pfam View protein in Pfam  
PF11326  DUF3128  
Amino Acid Sequences MGWWWSSAPKEGQSSTPAASSSPASQPPPETTSAPSQPPQPRTLTREEQADAEWKTLIASLESDISGQKQQQQQTPSAGNTTSSDSASSPSNSADPQAPPSSIAPESLYDDTMSCRSAFDYAFFCQSFGGQFVNVYRYGELRSCSEHWDNFWMCMKTRTLPDQQRRKAIRDHNRKKAIKYKTGPSSEDVWDVRTEPVQNAFSGDFAALEREMQAEEEEAARQKAATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.28
4 0.24
5 0.2
6 0.19
7 0.19
8 0.19
9 0.2
10 0.23
11 0.24
12 0.26
13 0.29
14 0.32
15 0.33
16 0.32
17 0.29
18 0.29
19 0.34
20 0.36
21 0.37
22 0.34
23 0.4
24 0.44
25 0.47
26 0.47
27 0.45
28 0.47
29 0.48
30 0.55
31 0.52
32 0.48
33 0.49
34 0.46
35 0.41
36 0.36
37 0.37
38 0.29
39 0.24
40 0.21
41 0.16
42 0.15
43 0.15
44 0.14
45 0.08
46 0.08
47 0.08
48 0.09
49 0.09
50 0.09
51 0.08
52 0.09
53 0.1
54 0.11
55 0.16
56 0.2
57 0.24
58 0.29
59 0.31
60 0.32
61 0.35
62 0.36
63 0.31
64 0.28
65 0.24
66 0.2
67 0.19
68 0.2
69 0.16
70 0.14
71 0.13
72 0.12
73 0.13
74 0.14
75 0.13
76 0.1
77 0.1
78 0.11
79 0.1
80 0.11
81 0.12
82 0.11
83 0.14
84 0.15
85 0.14
86 0.14
87 0.15
88 0.16
89 0.14
90 0.14
91 0.11
92 0.11
93 0.13
94 0.13
95 0.12
96 0.1
97 0.1
98 0.1
99 0.1
100 0.1
101 0.07
102 0.07
103 0.07
104 0.08
105 0.08
106 0.08
107 0.1
108 0.1
109 0.13
110 0.13
111 0.13
112 0.11
113 0.12
114 0.1
115 0.09
116 0.09
117 0.06
118 0.06
119 0.07
120 0.09
121 0.09
122 0.09
123 0.09
124 0.09
125 0.1
126 0.12
127 0.12
128 0.12
129 0.16
130 0.16
131 0.21
132 0.24
133 0.23
134 0.22
135 0.27
136 0.27
137 0.25
138 0.3
139 0.26
140 0.23
141 0.26
142 0.26
143 0.23
144 0.26
145 0.29
146 0.33
147 0.41
148 0.51
149 0.58
150 0.62
151 0.69
152 0.69
153 0.68
154 0.67
155 0.68
156 0.69
157 0.7
158 0.74
159 0.75
160 0.82
161 0.82
162 0.8
163 0.79
164 0.77
165 0.76
166 0.72
167 0.7
168 0.69
169 0.7
170 0.65
171 0.59
172 0.55
173 0.46
174 0.46
175 0.37
176 0.29
177 0.25
178 0.25
179 0.23
180 0.21
181 0.2
182 0.17
183 0.22
184 0.21
185 0.2
186 0.22
187 0.21
188 0.18
189 0.17
190 0.15
191 0.1
192 0.09
193 0.11
194 0.08
195 0.08
196 0.09
197 0.09
198 0.09
199 0.09
200 0.1
201 0.09
202 0.1
203 0.1
204 0.12
205 0.14
206 0.15
207 0.14