Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409YV99

Protein Details
Accession A0A409YV99    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
200-241LTTFIERRRMKRERRRRRKEREERRKRKREKREAMMKRMGVGBasic
NLS Segment(s)
PositionSequence
206-235RRRMKRERRRRRKEREERRKRKREKREAMM
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MGSTSAYDNSDCHRSGTTDEDSNSNTDRDTDDNGMPEYGESEYYASEGVASSRTLGGFLSNFMRRSGGKGRIPTSNDPAPPPAQMTPYPILGQTKRGGGEKDASGGRWGQTASSRTLGGFLSNFMRRSGGKGRIPTSNDPAPPPAQMTPYPILGQTKRGGGEKDASGGRWGQTMGVGAVDGRGMVELSLWRRLAWPVWMLTTFIERRRMKRERRRRRKEREERRKRKREKREAMMKRMGVGVGAGESAQGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.29
4 0.3
5 0.29
6 0.3
7 0.31
8 0.31
9 0.32
10 0.31
11 0.25
12 0.21
13 0.17
14 0.18
15 0.18
16 0.21
17 0.22
18 0.22
19 0.24
20 0.25
21 0.23
22 0.21
23 0.18
24 0.15
25 0.11
26 0.1
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.07
39 0.08
40 0.08
41 0.08
42 0.08
43 0.09
44 0.08
45 0.1
46 0.14
47 0.16
48 0.17
49 0.17
50 0.19
51 0.18
52 0.24
53 0.29
54 0.33
55 0.34
56 0.39
57 0.41
58 0.45
59 0.5
60 0.49
61 0.48
62 0.44
63 0.41
64 0.37
65 0.38
66 0.33
67 0.28
68 0.27
69 0.21
70 0.19
71 0.18
72 0.22
73 0.2
74 0.2
75 0.2
76 0.19
77 0.21
78 0.19
79 0.22
80 0.19
81 0.19
82 0.19
83 0.21
84 0.2
85 0.18
86 0.21
87 0.17
88 0.19
89 0.17
90 0.16
91 0.15
92 0.15
93 0.13
94 0.11
95 0.11
96 0.08
97 0.12
98 0.13
99 0.14
100 0.15
101 0.15
102 0.13
103 0.14
104 0.14
105 0.12
106 0.1
107 0.1
108 0.14
109 0.17
110 0.18
111 0.17
112 0.19
113 0.18
114 0.24
115 0.29
116 0.33
117 0.34
118 0.39
119 0.41
120 0.45
121 0.5
122 0.49
123 0.48
124 0.44
125 0.41
126 0.37
127 0.38
128 0.33
129 0.28
130 0.27
131 0.21
132 0.19
133 0.18
134 0.22
135 0.2
136 0.2
137 0.2
138 0.19
139 0.21
140 0.19
141 0.22
142 0.19
143 0.19
144 0.19
145 0.21
146 0.2
147 0.18
148 0.21
149 0.17
150 0.19
151 0.17
152 0.16
153 0.15
154 0.15
155 0.13
156 0.11
157 0.11
158 0.08
159 0.08
160 0.08
161 0.07
162 0.06
163 0.06
164 0.05
165 0.05
166 0.05
167 0.04
168 0.03
169 0.03
170 0.03
171 0.03
172 0.04
173 0.07
174 0.09
175 0.13
176 0.14
177 0.14
178 0.15
179 0.17
180 0.18
181 0.18
182 0.19
183 0.16
184 0.18
185 0.18
186 0.18
187 0.17
188 0.22
189 0.22
190 0.24
191 0.32
192 0.34
193 0.39
194 0.48
195 0.57
196 0.62
197 0.7
198 0.77
199 0.79
200 0.87
201 0.93
202 0.94
203 0.96
204 0.97
205 0.97
206 0.97
207 0.97
208 0.97
209 0.97
210 0.97
211 0.97
212 0.96
213 0.96
214 0.96
215 0.96
216 0.95
217 0.95
218 0.95
219 0.94
220 0.92
221 0.9
222 0.8
223 0.7
224 0.61
225 0.5
226 0.39
227 0.29
228 0.2
229 0.11
230 0.1
231 0.08