Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409YKD0

Protein Details
Accession A0A409YKD0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
74-101LKEGKTIKSSTQKKTRRKAPRNEIDDIFHydrophilic
NLS Segment(s)
PositionSequence
86-92KKTRRKA
Subcellular Location(s) cyto_nucl 15.5, cyto 13.5, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MIDVGGYCKASPLLQDGDGVIASSTEKDLFASESTVINAAISEFSTQTFSKDLTEEQVLIEVKPSAQPAPQQNLKEGKTIKSSTQKKTRRKAPRNEIDDIFGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.15
5 0.15
6 0.14
7 0.09
8 0.06
9 0.06
10 0.06
11 0.07
12 0.06
13 0.06
14 0.06
15 0.07
16 0.08
17 0.09
18 0.09
19 0.1
20 0.1
21 0.1
22 0.1
23 0.09
24 0.08
25 0.07
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.08
33 0.08
34 0.09
35 0.09
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.1
42 0.1
43 0.09
44 0.11
45 0.11
46 0.1
47 0.11
48 0.08
49 0.08
50 0.09
51 0.1
52 0.08
53 0.09
54 0.14
55 0.18
56 0.26
57 0.31
58 0.31
59 0.35
60 0.41
61 0.41
62 0.43
63 0.4
64 0.36
65 0.37
66 0.39
67 0.4
68 0.44
69 0.51
70 0.54
71 0.62
72 0.68
73 0.72
74 0.8
75 0.84
76 0.85
77 0.87
78 0.89
79 0.9
80 0.91
81 0.87
82 0.83
83 0.75