Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409YLU8

Protein Details
Accession A0A409YLU8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-89AAREATKRVKRRRGGRRGKKKEGVDBasic
NLS Segment(s)
PositionSequence
70-85TKRVKRRRGGRRGKKK
Subcellular Location(s) nucl 13, mito 8, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MPMDTVVVRLSTIDTSTLGCTKNRDLNDNHASSNSCDEQKEGLSVLQDSSLMKEGGDIDVGITTAAREATKRVKRRRGGRRGKKKEGVDLCHREEGSTMVEDEGQGLEDVVLRDTRHHDAGMNLEIEDGSHSLDAXGHGDQAFWWIFRGPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.13
4 0.16
5 0.16
6 0.17
7 0.2
8 0.25
9 0.31
10 0.32
11 0.35
12 0.35
13 0.42
14 0.49
15 0.47
16 0.43
17 0.38
18 0.37
19 0.33
20 0.35
21 0.28
22 0.22
23 0.2
24 0.21
25 0.2
26 0.19
27 0.19
28 0.15
29 0.12
30 0.11
31 0.12
32 0.11
33 0.09
34 0.09
35 0.08
36 0.09
37 0.1
38 0.09
39 0.08
40 0.09
41 0.09
42 0.09
43 0.09
44 0.07
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.03
51 0.03
52 0.04
53 0.04
54 0.04
55 0.07
56 0.17
57 0.24
58 0.33
59 0.42
60 0.5
61 0.58
62 0.67
63 0.76
64 0.78
65 0.82
66 0.84
67 0.87
68 0.88
69 0.9
70 0.87
71 0.78
72 0.76
73 0.72
74 0.67
75 0.65
76 0.61
77 0.55
78 0.51
79 0.48
80 0.39
81 0.33
82 0.28
83 0.2
84 0.15
85 0.12
86 0.08
87 0.09
88 0.08
89 0.09
90 0.07
91 0.06
92 0.05
93 0.05
94 0.04
95 0.06
96 0.06
97 0.07
98 0.08
99 0.08
100 0.1
101 0.14
102 0.18
103 0.18
104 0.18
105 0.18
106 0.18
107 0.22
108 0.23
109 0.2
110 0.16
111 0.15
112 0.14
113 0.13
114 0.13
115 0.09
116 0.07
117 0.06
118 0.06
119 0.06
120 0.07
121 0.09
122 0.08
123 0.11
124 0.1
125 0.1
126 0.1
127 0.14
128 0.14
129 0.12
130 0.13