Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409YJK1

Protein Details
Accession A0A409YJK1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-123VKRGTGEPKPMSRRKRRKKYRGLAYDPNSBasic
NLS Segment(s)
PositionSequence
99-115TGEPKPMSRRKRRKKYR
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MGSTSANALYIDLSHTRSKSDNVDVELDSREPYTIQNPRMAIAIAIGSSHHPTESALTTLSLNDPCLDTDDDIDAQNTMRNENVFENTGLQLELVKRGTGEPKPMSRRKRRKKYRGLAYDPNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.22
5 0.25
6 0.27
7 0.32
8 0.32
9 0.31
10 0.33
11 0.31
12 0.31
13 0.29
14 0.25
15 0.19
16 0.15
17 0.13
18 0.1
19 0.11
20 0.17
21 0.22
22 0.23
23 0.26
24 0.26
25 0.26
26 0.27
27 0.25
28 0.18
29 0.12
30 0.1
31 0.06
32 0.06
33 0.05
34 0.06
35 0.07
36 0.07
37 0.06
38 0.06
39 0.06
40 0.08
41 0.09
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.1
48 0.08
49 0.07
50 0.07
51 0.07
52 0.06
53 0.09
54 0.09
55 0.08
56 0.09
57 0.09
58 0.1
59 0.1
60 0.1
61 0.07
62 0.07
63 0.09
64 0.08
65 0.08
66 0.08
67 0.08
68 0.1
69 0.12
70 0.14
71 0.13
72 0.13
73 0.14
74 0.14
75 0.14
76 0.12
77 0.1
78 0.1
79 0.09
80 0.12
81 0.12
82 0.11
83 0.11
84 0.13
85 0.19
86 0.2
87 0.27
88 0.29
89 0.37
90 0.47
91 0.55
92 0.64
93 0.7
94 0.79
95 0.83
96 0.88
97 0.91
98 0.93
99 0.95
100 0.96
101 0.95
102 0.95
103 0.92