Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409YLA5

Protein Details
Accession A0A409YLA5    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-55YTDLLTQKKDIKRQKDRLVSLKKEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, mito_nucl 11.332, cyto_mito 10.332, cyto_nucl 8.666, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016818  NOSIP  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0061630  F:ubiquitin protein ligase activity  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MRRFDACALCLNSAREPLVCQEGHLFCKECVYTDLLTQKKDIKRQKDRLVSLKKEAEEERARARQAARERVLEEFERGQLGLSGGVSSIAAKAKAMAEADEPKTGSKRKFEFSADTVKTLAAEAEEAAMRQIEKEQAAALKAKLPDFWLPSLTPTYKANLSEPKTLDDLKIPSHTMCRGGVEAHPLALKGLIPIHFTMYTASSPPTGSANSTPSTSTSTTTKQAEGEPMCPSCKKRLSNNILLFCSKACGHVTCKTCTDTLVKPALQCIVCDKKLQKDDVIELKREGTGFAGGGLAETKKSGIAFQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.22
4 0.23
5 0.26
6 0.23
7 0.22
8 0.26
9 0.29
10 0.31
11 0.33
12 0.32
13 0.26
14 0.32
15 0.31
16 0.25
17 0.24
18 0.24
19 0.21
20 0.24
21 0.32
22 0.3
23 0.31
24 0.32
25 0.38
26 0.41
27 0.49
28 0.54
29 0.56
30 0.64
31 0.73
32 0.81
33 0.82
34 0.83
35 0.84
36 0.85
37 0.8
38 0.77
39 0.73
40 0.64
41 0.59
42 0.53
43 0.51
44 0.46
45 0.45
46 0.44
47 0.43
48 0.42
49 0.41
50 0.41
51 0.4
52 0.43
53 0.49
54 0.44
55 0.43
56 0.44
57 0.42
58 0.44
59 0.38
60 0.33
61 0.24
62 0.22
63 0.19
64 0.17
65 0.15
66 0.12
67 0.12
68 0.09
69 0.07
70 0.06
71 0.05
72 0.06
73 0.05
74 0.05
75 0.06
76 0.06
77 0.06
78 0.06
79 0.08
80 0.08
81 0.1
82 0.1
83 0.09
84 0.11
85 0.16
86 0.18
87 0.18
88 0.18
89 0.18
90 0.21
91 0.25
92 0.26
93 0.28
94 0.3
95 0.32
96 0.36
97 0.38
98 0.39
99 0.37
100 0.44
101 0.37
102 0.35
103 0.32
104 0.28
105 0.24
106 0.19
107 0.16
108 0.06
109 0.05
110 0.04
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.06
119 0.07
120 0.07
121 0.07
122 0.08
123 0.08
124 0.1
125 0.11
126 0.1
127 0.12
128 0.13
129 0.13
130 0.13
131 0.14
132 0.16
133 0.16
134 0.17
135 0.15
136 0.14
137 0.15
138 0.17
139 0.16
140 0.15
141 0.13
142 0.15
143 0.14
144 0.15
145 0.17
146 0.21
147 0.24
148 0.27
149 0.28
150 0.28
151 0.28
152 0.28
153 0.25
154 0.21
155 0.19
156 0.15
157 0.16
158 0.15
159 0.14
160 0.16
161 0.16
162 0.15
163 0.14
164 0.14
165 0.12
166 0.13
167 0.13
168 0.15
169 0.14
170 0.13
171 0.12
172 0.11
173 0.11
174 0.1
175 0.09
176 0.05
177 0.07
178 0.08
179 0.09
180 0.09
181 0.11
182 0.11
183 0.11
184 0.12
185 0.11
186 0.11
187 0.11
188 0.11
189 0.09
190 0.1
191 0.1
192 0.11
193 0.1
194 0.11
195 0.12
196 0.15
197 0.15
198 0.16
199 0.15
200 0.15
201 0.18
202 0.17
203 0.17
204 0.18
205 0.2
206 0.24
207 0.26
208 0.26
209 0.23
210 0.24
211 0.29
212 0.27
213 0.26
214 0.25
215 0.25
216 0.26
217 0.28
218 0.29
219 0.3
220 0.36
221 0.39
222 0.45
223 0.55
224 0.61
225 0.68
226 0.74
227 0.71
228 0.66
229 0.62
230 0.53
231 0.42
232 0.37
233 0.27
234 0.21
235 0.17
236 0.17
237 0.21
238 0.28
239 0.32
240 0.32
241 0.35
242 0.35
243 0.33
244 0.32
245 0.33
246 0.29
247 0.32
248 0.35
249 0.33
250 0.31
251 0.33
252 0.37
253 0.32
254 0.29
255 0.3
256 0.32
257 0.32
258 0.38
259 0.4
260 0.43
261 0.49
262 0.52
263 0.48
264 0.44
265 0.5
266 0.54
267 0.56
268 0.49
269 0.44
270 0.42
271 0.39
272 0.35
273 0.28
274 0.19
275 0.16
276 0.13
277 0.12
278 0.11
279 0.09
280 0.09
281 0.11
282 0.09
283 0.08
284 0.09
285 0.09
286 0.1
287 0.1