Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409YYF8

Protein Details
Accession A0A409YYF8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-52PPTLHHEQAKKKRKRVSRKAGRDSDSBasic
NLS Segment(s)
PositionSequence
35-47AKKKRKRVSRKAG
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MIKALRLVNEFNYYTKHQTPGAASTAPPTLHHEQAKKKRKRVSRKAGRDSDSDSDYVEQSQGRAQDSEDELPDRIYQSDGEELASDVRKGLVSTNTPGRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.33
4 0.28
5 0.3
6 0.31
7 0.3
8 0.3
9 0.25
10 0.22
11 0.21
12 0.23
13 0.2
14 0.19
15 0.22
16 0.22
17 0.26
18 0.31
19 0.35
20 0.42
21 0.53
22 0.62
23 0.64
24 0.68
25 0.71
26 0.76
27 0.81
28 0.82
29 0.83
30 0.83
31 0.86
32 0.88
33 0.87
34 0.8
35 0.71
36 0.64
37 0.55
38 0.45
39 0.34
40 0.25
41 0.19
42 0.16
43 0.14
44 0.11
45 0.08
46 0.07
47 0.09
48 0.1
49 0.1
50 0.1
51 0.1
52 0.13
53 0.16
54 0.17
55 0.17
56 0.17
57 0.16
58 0.16
59 0.17
60 0.14
61 0.12
62 0.11
63 0.1
64 0.11
65 0.13
66 0.12
67 0.12
68 0.12
69 0.12
70 0.14
71 0.14
72 0.12
73 0.1
74 0.11
75 0.11
76 0.11
77 0.14
78 0.17
79 0.19
80 0.25